KEGG   Thauera sp. MZ1T: Tmz1t_1436Help
Entry
Tmz1t_1436        CDS       T00804                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00620  Pyruvate metabolism
tmz00680  Methane metabolism
tmz01100  Metabolic pathways
tmz01120  Microbial metabolism in diverse environments
tmz01200  Carbon metabolism
Module
tmz_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tmz1t_1436
  Energy metabolism
   00680 Methane metabolism
    Tmz1t_1436
Enzymes [BR:tmz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Tmz1t_1436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ACK54195
UniProt: C4ZNN2
LinkDB All DBs
Position
complement(1598972..1601734)
Genome map
AA seq 920 aa AA seqDB search
MNQDKDAPLRDDIRLLGRLLGDTVRDQQGEAAFGLIERIRQNSVRFRRDDDIAARRELED
ILDALSREQTIQVVRAFSYFSHLANIAEDQHHIRRSRAHLIAGSAPREGSLAHALERALD
SGAADPAALAGFFDGALVSPVLTAHPTEVQRKSILNCETVIARLLDARDRMQLTPEEAEA
NDEALRRAVLTLWQTRMLRTAKLSVIDEVNNGLSYFETTFLRELPRLYASLEDRLAAADR
ALGTPELAAFVQVGSWIGGDRDGNPFVTAEVLERALAMQCAVALGHYLDELHILGSQLSL
GIGLVSASDALLALAEASPDHSPHRSDEPYRRAISGIYARLAATYRSLLGHDPLRHAVAA
AQPYPSAAALAEDLEVLHRSLAANGSGALTRGRLRHLRRAVKVFGFHLAPLDLRQNSDVH
ERTVAELLERACPGTAYASLDEDARCALLLEELATARPLASPHVRYTDETEGELAIFRAA
RQAHLRYGTAAIRNCIISKTDDVSDLLELAVLLKEAGLLRPLENALDVNIVPLFETIGDL
ENAAGVMARIFSIPAYRGLLEARDHTQEVMLGYSDSNKDGGFLTSGWALYKAEGELVETF
ARHGVRLRLFHGRGGSVGRGGGPSYQAILAQPEGAVQGQIRLTEQGEVIGAKYGNPEVGR
RNLEVLVAATLESSLRPASASPTPPAFLDAMQALSDAAFAAYRGLVYETEGFERYFWEST
VISEIAALNIGSRPASRKKSTAIEDLRAIPWVFSWSQCRVMLPGWYGFGSAVRDFLTANP
DDGLALLQRMNMEWPFFQTLLSNMDMVLSKTDLAIASRYAELVKDAALRDTIFGRIRAEH
QATVGAVLRITGQSELLDANPLLKRSIRNRFPYLDPLNHVQVELLRRHRDAAEAGGIDER
IRLGIHISINGIAAGLRNSG
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaggacaaggacgcccccctccgcgacgacatccgcctgctcggccgcctgctc
ggcgacaccgtgcgcgaccagcagggcgaggccgcattcggcctcatcgaacgcatccgc
cagaactcggtgcgcttccgccgcgacgacgacatcgccgcgcgccgcgagctggaggac
atcctcgacgccttgtcacgcgagcagaccatccaggtggtgcgcgccttcagctatttc
tcccacctggccaacatcgccgaggaccagcaccacatccggcgctcgcgcgcgcacctg
atcgccggctcggcaccgcgcgagggcagcctggcgcacgcgctcgagcgcgcgctcgac
agcggtgcggccgaccccgcggcgctggccggcttcttcgacggcgcgctggtgtcgccg
gtgctcaccgcccaccccaccgaggtgcagaggaagagcatcctcaactgcgagaccgtg
atcgcgcggctcctggacgcgcgcgaccgcatgcagctcacccccgaggaggccgaggcc
aacgacgaggcgctgcgtcgcgcggtgctgacgctgtggcagacgcgcatgctgcgcacc
gccaagctgtcggtgatcgatgaggtcaacaacggcctgtcctacttcgagaccaccttc
ctgcgcgaactgccacggctctacgccagcctggaggaccgtctcgccgccgccgaccgg
gcgctgggcacgcccgagctcgccgccttcgtgcaggtggggagctggatcggcggcgac
cgcgacggcaaccccttcgtcaccgccgaggtgctcgagcgcgcgctcgccatgcagtgc
gcggtcgcgctcgggcattatctggacgagttgcacatcctgggctcgcagctctcgctc
ggcatcggcctggtctcggcctccgatgccctgctcgcgcttgccgaggcctcgcccgac
cactcgccgcatcgcagcgacgagccctaccggcgcgcgatctcgggcatctacgcgcgc
ctggccgccacctaccgcagcctgcttggccacgacccgctacgccacgcggtcgccgcc
gcccagccctacccgagcgcggccgcgctcgccgaggacctcgaggtgctgcaccgctcg
ctcgccgccaacggctcgggcgcgctcacgcgcgggcggctgcgccacctgcgccgcgcg
gtgaaggtgttcggcttccatctcgccccgctcgacctgcgccagaactcggatgtgcac
gaacgcacggtcgccgagctgctcgaacgcgcctgccccggcaccgcctatgccagcctc
gacgaggacgcgcgctgtgcgctgctgctcgaagaactcgccaccgcgcgcccgctcgcc
tcgccgcacgtccgctacacggacgagaccgagggcgagctggcgatcttccgcgccgcc
cgccaggcccacctgcgctacggcacggcggcgatccgcaactgcatcatctccaagacc
gacgacgtctccgacctgctcgaactcgcggtactgctgaaggaggcgggcctcctgcgc
ccgctcgagaacgcgctcgacgtgaacatcgtgccgctcttcgagaccatcggcgacctc
gagaacgccgccggcgtgatggcgcgcatcttctcgatccccgcctaccgcggactgctc
gaagcgcgcgaccacacccaggaggtcatgctcggctactccgacagcaacaaggacggc
ggcttcctgacctcgggctgggcgctctacaaggccgagggcgagctggtcgaaaccttc
gcgcgccacggcgtgcgcctgcgcctcttccacggccgcggtggctcggtgggccgtggc
ggcggcccgagctaccaggccatcctcgcccagcccgagggcgcggtgcaggggcagatc
cgcctcaccgaacagggcgaggtgatcggcgccaaatatggcaatccggaagtcggccgg
cgcaacctcgaggtgctggtcgccgccacgctcgagtccagcctgcgcccggccagcgcc
agcccgacgccgcccgccttcctcgacgccatgcaggcgctctcggacgcggccttcgcg
gcctaccggggcctggtctacgagaccgagggtttcgagcgctacttctgggagtcgacc
gtgatcagcgagatcgcggcgctcaacatcggcagccgcccggcctcgcgcaagaagagc
accgcgatcgaggacctgcgcgcgatcccctgggtgttcagctggtcgcagtgccgggtg
atgctgccgggctggtacggcttcggcagcgcggtgcgcgatttcctcaccgccaacccg
gacgacggcctggcgctcttgcagcgcatgaacatggaatggcccttcttccagaccctg
ctgtcgaacatggacatggtgctgtccaagaccgacctcgcgatcgccagccgctacgcc
gagctggtcaaggacgcggcgctgcgcgacacgatcttcgggcgcatccgcgccgagcac
caggccacggtcggggcggtgctgcggatcaccggccagagcgagctgctcgacgccaac
ccgctgctcaagcgctcgatccgcaaccgcttcccctacctcgacccgctcaaccacgtc
caggtcgagctgctgcgccgccaccgcgacgccgccgaggcgggcggcatcgacgagcgc
atccggctcggcatccacatctccatcaacggcatcgccgcgggcttgcgcaacagcggc
tga

DBGET integrated database retrieval system