KEGG   Thauera sp. MZ1T: Tmz1t_2543Help
Entry
Tmz1t_2543        CDS       T00804                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00020  Citrate cycle (TCA cycle)
tmz00310  Lysine degradation
tmz00380  Tryptophan metabolism
tmz01100  Metabolic pathways
tmz01110  Biosynthesis of secondary metabolites
tmz01120  Microbial metabolism in diverse environments
tmz01130  Biosynthesis of antibiotics
tmz01200  Carbon metabolism
Module
tmz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tmz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tmz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tmz1t_2543
  09105 Amino acid metabolism
   00310 Lysine degradation
    Tmz1t_2543
   00380 Tryptophan metabolism
    Tmz1t_2543
Enzymes [BR:tmz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Tmz1t_2543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ACR01145
UniProt: C4K9R9
LinkDB All DBs
Position
complement(2742707..2743897)
Genome map
AA seq 396 aa AA seqDB search
MLIEVKVPQLSESVSEATLVTWHKKEGDAVARDENLIDIETDKVVLETPAPADGVLVKII
KQGGDTVTSGELIAQIDTEAKAAAAAAAPAAAPAAAAPAAAAAASGAAGAASPAARKILD
EKGIAAGDVAGSGRGGRVTKEDAVAAQPKAAAAAASAAVQLTGDRPEERVPMTRLRARIA
ERLIQSKNENAILTTFNEVNMAPVMALRKQYGDKFEKAHGVRLGFMGFFVKAAVAALKKF
PILNASVDGNDIVYHGYIDIGIAVGSPRGLVVPILRNAETMSIAEIELKIAEFGQKAKDG
KLSLDDLSGGTFSISNGGVFGSMMSTPIINPPQSAILGIHATKDRAVVENGQVVVRPINY
LAMSYDHRIIDGREAVLGLVTMKEALEDPARLILDV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcgaagtcaaagtaccgcagctgtccgagtcggtttccgaagccacgctggtc
acctggcacaagaaggaaggcgacgcggtcgcgcgcgacgagaacctgatcgacatcgag
accgacaaggtcgtgctcgagaccccggccccggccgacggtgttctggtgaagatcatc
aagcagggtggcgacaccgtgacctcgggtgagctgatcgcccagatcgacaccgaagcc
aaggccgccgccgccgccgcggctccggccgcagccccggctgcggccgcacccgccgcc
gctgcggcggcgtccggtgccgccggcgccgccagcccggccgcgcgcaagatcctcgac
gagaagggcatcgccgccggcgacgtcgccggctccggccgtggcggtcgcgtgaccaag
gaagatgccgtcgccgcccagcccaaggccgccgcagccgcggcgtcggccgcggtgcag
ctcaccggcgaccgtcctgaagagcgcgtgccgatgacccgcctgcgtgcccgcatcgcc
gagcgcctgatccagtcgaagaacgagaacgccatcctgaccacgttcaacgaggtcaac
atggcgcccgtcatggccctgcgcaagcagtacggcgacaagttcgagaaggcgcacggt
gtccgtctcggtttcatgggcttcttcgtcaaggcggccgtggccgcgctgaagaagttc
ccgatcctgaacgcctcggtcgatggcaacgacatcgtctaccacggctacatcgacatc
ggcatcgcggtcggctcgccgcgcggcctggtggtgccgatcctgcgcaacgccgagacc
atgtcgattgccgagatcgaactgaagatcgccgagttcggccagaaggccaaggacggc
aagctctcgctcgacgacctctccggcggcaccttctcgatctccaacggcggcgtgttc
ggctcgatgatgtcgaccccgatcatcaacccgccgcagtcggccatcctcggcatccac
gccaccaaggatcgtgccgtggtcgagaacggccaggtcgtggttcgtccgatcaactat
ctggccatgtcctacgaccaccgcatcatcgacggtcgcgaggcggtgctcggcctggtg
acgatgaaggaagcgctggaagatccggctcgcctgatcctggatgtgtga

DBGET integrated database retrieval system