KEGG   Thauera sp. MZ1T: Tmz1t_2811Help
Entry
Tmz1t_2811        CDS       T00804                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00030  Pentose phosphate pathway
tmz01100  Metabolic pathways
tmz01120  Microbial metabolism in diverse environments
tmz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tmz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tmz1t_2811
Enzymes [BR:tmz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Tmz1t_2811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ACR01410
UniProt: C4KAI4
LinkDB All DBs
Position
complement(3037844..3039691)
Genome map
AA seq 615 aa AA seqDB search
MGWNRKVLRVNLTAGTCTEEALNMQWADEYLGSRGLATKYLVSEIDPRVDPLSPDNKMIM
ATGPLTGTMASTGGRYTVVTKGPLTGAIACSNSGGFFGAEMKFAGWDMVIFEGKSAKPVW
LYIENDKAELRDASGLWGRSCWETEEKIKEQLQDPLVRISSIGVSGENQVLYSCIVNDLH
RAAGRSGVGAVMGSKNLKAVAIRGTKGVSGIKDFGAFLKATNDAKKVLADNAVTGQGLPK
YGTQVLMNVINEIGALPTRNHRDVQFEDASKISAEAMHEKRASDGKTHLVTNAACFGCTI
ACGRISEIDKTHFTVKNSPKYWGASGGLEYEAAWALGAANGVGDLEALQYANLICNEQGM
DPISFGATVGAAMELYELGLLDDAKIGIAAPFGSAEALAKMVEMTALGEGFGKELGLGSK
RLCEKYGRPELSMSVKGQEFPAYDSRGIQGMGLAYATSNRGACHLRGYTVASEVLGIPVK
TDPLTTDGKPELVKAFQDATAVFDSAGICVFTSFAWTLADVQPQVAAACEGDWSMEKLNE
VGERIWNMERMFNNAAGFTAKDDNLPPRLTQEPAKTGPAKGLVNGLAKMLPEYYQVRGWT
PGGEPTAETRARLGL
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgggatggaatcgcaaagtcctgcgcgtgaacctgaccgcagggacctgtaccgaagaa
gcgctgaacatgcagtgggccgacgaatacctcggctcgcgcgggctggccaccaagtac
ctggtgtccgagatcgaccccagggtcgacccgctgtcgcccgacaacaagatgatcatg
gccaccgggccgctcaccggcaccatggcctcgaccggtggccgctacaccgtggtcacc
aaggggccgctgaccggcgccatcgcgtgctcgaactcgggcggcttcttcggcgccgag
atgaagttcgccggctgggacatggtgatcttcgagggcaagtcggccaagccggtatgg
ctctacatcgagaacgacaaggccgagctgcgtgacgcttccggcctgtggggcaggagc
tgctgggaaaccgaggagaagatcaaggagcaactccaggacccgctggtgcgcatctcc
tcgatcggcgtctcgggcgagaaccaggtgctctattcctgcatcgtcaatgacctgcac
cgtgccgccgggcgctccggcgtgggtgcggtgatgggctcgaagaacctcaaggcggtg
gcgatccgcggcaccaagggcgtctccggcatcaaggacttcggcgccttcctgaaggcc
acgaacgacgccaagaaagtgctcgccgacaacgcggtcaccggccagggcctgcccaag
tacggcacccaggtgctgatgaacgtgatcaacgagatcggcgcgctgcccacgcgcaac
caccgcgacgtgcagttcgaggacgcctcgaagatctccgccgaggccatgcacgagaag
cgcgcgtccgacggcaagacccacctcgtcaccaatgccgcctgcttcgggtgcacgatc
gcctgcgggcgcatctccgagatcgacaagacccacttcacggtcaagaacagcccgaag
tactggggcgcctccggcggcctggagtacgaagcggcgtgggcgctcggcgcggccaac
ggcgtgggcgacctcgaggcgctgcagtacgccaacctgatctgcaacgagcagggcatg
gacccgatctccttcggcgccactgtcggcgcggcgatggagctctacgagctgggcctc
ctcgacgacgcgaagatcggcatcgcagcgcccttcggctcggccgaggcgctggcgaag
atggtcgagatgaccgcgctcggcgagggtttcggcaaggagctcggcctgggcagcaag
cgcctgtgcgagaagtacggccgtcccgagctgtcgatgagcgtgaaggggcaggaattc
cccgcctacgactcgcgcggcatccagggcatgggcctggcctacgccacctccaaccgc
ggcgcctgccacctgcgtggctataccgtggcgtcggaggtgctcggcatcccggtcaag
accgacccgctcaccaccgatggcaagcccgagctggtgaaggccttccaggacgccacc
gcggtgttcgactccgccgggatctgcgtgttcaccagcttcgcgtggaccctggccgac
gtgcagccgcaggtcgccgcggcgtgcgagggcgactggagcatggagaagctcaacgag
gtgggcgagcgcatctggaacatggagcgcatgttcaacaacgccgccggcttcaccgcc
aaggatgacaacctgccgccgcgcctcacccaggaaccggccaagaccggcccggccaag
ggcctggtcaacggcctggcgaagatgctgcccgagtactatcaggtgcgcggatggacg
ccgggtggcgagccgaccgcggagacacgggcacgcctgggcctgtga

DBGET integrated database retrieval system