KEGG   Thauera sp. MZ1T: Tmz1t_3612Help
Entry
Tmz1t_3612        CDS       T00804                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
tmz  Thauera sp. MZ1T
Brite
KEGG Orthology (KO) [BR:tmz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Tmz1t_3612
Enzymes [BR:tmz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Tmz1t_3612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 DAO FAD_oxidored AlaDh_PNT_C FAD_binding_3 NAD_binding_8 NAD_binding_7 Glutaredoxin FMO-like K_oxygenase Thi4 Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: ACR02205
UniProt: C4KDN9
LinkDB All DBs
Position
complement(3968174..3969733)
Genome map
AA seq 519 aa AA seqDB search
MLDANIKTQLKAYLERVTQPIEIVASLDDGPKSKELLELLHDVTEQSKLITLVERRDDDE
RKPSFSVGPRGGEARVRFAGLPMGHEFTSLILALLQAGGYPPKVEAEVIEQIRNLDVELN
FETYISLSCHNCPDVVQALNLMAVLNPKIRHTMIDGALFQKEVEERQIMAVPTVYLNGEE
FDQGRLELGQILAKVDTGAAARDARKLSEKPAFDVLVVGGGPAGAAAAIYAARKGIRTGV
VAERFGGQVMDTLAIENFISVKYTEGPKLVASLEEHVKEYEVDVMNLQRVAGVVPGENLH
EVKMENGASLKAKTVIVATGARWREMNVPGEKEFRGKGVAYCPHCDGPLFKGKRVAVIGG
GNSGVEAAIDLAGVVAHVTLLEFADDLRADAVLQKKLYSLPNVSVIKSAQTTEVTGADKV
NGLVYKDRKTNAEHRLELEGIFVQIGLLPNTDFLRGTLELSRFGEVIVDAKGQTSVPGIF
AAGDCTTVPYKQIIIAMGEGAKASLSAFDHLIRSSAPTM
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccaacatcaagactcaactgaaagcctacctggagcgggtgacgcagccg
atcgagatcgtggcgtcgctggatgatggtccgaagtcgaaggaactgctcgagctgctg
cacgacgtcaccgagcagtcgaagctgatcaccctggtcgagcgtcgcgatgacgacgaa
cgcaagccctcgttctcggtcggaccgcgcggcggcgaggcgcgcgtgcgcttcgcaggc
ctgcccatgggccacgagttcacctcgctgatcctcgccctgctgcaggccggcggctac
ccgcccaaggtcgaggccgaggtgatcgagcagatcaggaacctcgacgtcgagctgaac
ttcgagacctacatctcgctgtcctgccacaactgcccggacgtggtgcaggcgctcaac
ctgatggcggtgctcaacccgaagatccgccacaccatgatcgatggcgcgctgttccag
aaggaagtcgaggagcgccagatcatggcggtgccgacggtgtacctgaacggcgaggag
ttcgaccagggccgcctcgagctcggccagatcctcgccaaggtcgacaccggcgccgcg
gcgcgcgacgccaggaagctctccgagaagccggccttcgacgtgctcgtcgtggggggc
ggaccggccggcgcggcggcggcgatctacgccgcgcgcaagggcatccgcaccggcgtg
gtggccgagcgcttcggcggccaggtcatggacacgctggcgatcgagaacttcatctcg
gtgaagtacaccgaaggccccaagctggtcgccagcctggaggagcacgtcaaggaatac
gaagtcgacgtcatgaacctgcagcgcgttgccggcgtggtgccgggcgagaacctgcac
gaggtgaagatggagaacggcgccagcctcaaggccaagaccgtgatcgtcgccaccggt
gcgcgctggcgcgagatgaacgtgcccggcgagaaggagttccgcggcaagggcgtggcc
tactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatcggcggc
ggcaactccggcgtcgaggccgcgatcgacctcgccggcgtggtcgcccacgtgaccctg
ctcgagttcgccgacgacctgcgcgccgacgccgtgctgcagaagaagctctacagcctg
cccaacgtcagcgtgatcaagagcgcgcagaccaccgaggtcaccggtgccgacaaggtg
aatggcctggtgtacaaggatcgcaagaccaacgccgagcaccgtctcgagctcgaaggc
atcttcgtgcagatcggcctgctgcccaacaccgacttcctcaggggcacgctcgaactg
tcgcgcttcggcgaggtgatcgtggacgccaagggccagacctcggtgccgggcatcttc
gccgccggcgactgcaccacggtgccgtacaagcagatcatcatcgccatgggcgaaggt
gccaaggcttcgctgtccgccttcgaccacctgatccgcagcagcgcgccgaccatgtaa

DBGET integrated database retrieval system