KEGG   Thermotoga neapolitana: CTN_1407Help
Entry
CTN_1407          CDS       T00847                                 

Definition
(GenBank) Alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
tna  Thermotoga neapolitana
Pathway
tna00500  Starch and sucrose metabolism
tna01100  Metabolic pathways
tna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CTN_1407
Enzymes [BR:tna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     CTN_1407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417
Motif
Other DBs
NCBI-ProteinID: ACM23583
UniProt: B9K9F0
LinkDB All DBs
Position
complement(1375574..1378045)
Genome map
AA seq 823 aa AA seqDB search
MLKKLPENLEHLEELAYNLWWSWSRPAQRLWRKIDPEGWEEHRNPVKILKEVSDERLEEL
SKDDDFISLYELTIERFKDYMEKEDTWFNVNYPEWDEKIVYMCMEYGLTKALPIYSGGLG
ILAGDHLKSASDLGLPLIAIGLLYKHGYFTQQIDRDGKQIEIFPDYNPEDLPMKPLKDEK
GNQVIVEVPLDSTVVKARVFEVKVGRVSLYLLDPDIEENEERYRKICNYLYNPEPDVRVS
QEILLGIGGMKLLRALNLKPGVIHLNEGHPAFSSLERIKNYMEEGYSFTEALEIVRQTSV
FTTHTPVPAGHDRFPFDLVEKKLSKFFEGFEKRNLLMDLGKDETGSFNMTYLALRTSSFI
NGVSKLHAEVSRRMFKNVWQGVPVEEIPIEGITNGVHMGTWINREMRKLYDRYLGRVWRD
HTDLEGIWYGVDRIPDEELWQAHLRAKKRFIEYIKESVRRRNERLGIDEDVPNIDENSLI
IGFARRFATYKRAVLLLSDLERLKKILNDPERPVYVVYAGKAHPRDDAGKEFLKRIYEVS
QMPEFKNRIIVLENYDIGMARLMVSGVDVWLNNPRRPMEASGTSGMKAAANGVLNASVYD
GWWVEGYNGRNGWVIGDESVLPETEVDDPRDAEALYDLLENEIIPTYYENKEKWIFMMKE
SIKSVAPRFSTTRMLKEYTEKFYIKGLVNKEWLERKENAERFGAWKERILRNWSSVSIER
IVLEDTRSVEVTVKLGDLSPDDVLVELLIGRGESMEDLEIWKVIQIRKHRREGDLFIYSY
VNGALGHLGSPGWFYAVRVLPYHPKLPTRFLPEIPVVWKKVLG
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaagaaactcccggagaatctggagcatctggaagaactcgcctacaacctctgg
tggagctggtctaggcccgctcagagactctggagaaagatagatccggaaggctgggag
gaacacagaaaccccgttaaaatactgaaagaagtttctgatgaaaggctcgaagaactt
tcaaaagatgatgatttcatatccctctacgaactcaccattgaaaggttcaaggattac
atggagaaagaagacacctggttcaacgtgaactaccccgaatgggacgagaagatcgtc
tacatgtgtatggagtacggtttgaccaaagcccttccgatctactccggtggtcttgga
atcctcgcgggagaccatctcaaatccgcaagcgatcttggacttcctctcatagcgatc
ggacttctctacaaacatggatatttcacccagcagatcgacagagatggaaaacagata
gagattttccctgattacaacccagaggacttacccatgaagcccctgaaggatgaaaag
ggaaaccaggtgatcgtggaggttcctctcgacagtaccgtggtgaaggcacgtgttttt
gaagtgaaggtaggaagggtgagtctgtacctgctcgatccggacatcgaggaaaacgag
gaacgatacagaaagatctgcaactacctttacaacccggaacccgatgtgagggtctcc
caggagatactcctcggaattgggggaatgaagcttctcagggctctgaacctgaaacca
ggagtcatccatctgaacgaaggacatccggcgttctcttccctcgaaaggataaagaac
tacatggaagaaggatattccttcacagaggcccttgagatcgtgagacagacgagtgtg
tttacaacccacacacccgttcccgctggacacgacagatttccctttgacctcgtggaa
aagaaactttcgaaattcttcgaaggattcgaaaagagaaatcttctcatggatcttggg
aaagatgaaacaggcagtttcaacatgacgtatcttgccctgagaacgtcctctttcata
aacggcgtgagcaaactgcatgcggaagtttccagaaggatgttcaaaaacgtgtggcag
ggtgttcccgtggaggaaataccgatcgaagggataacgaacggcgttcacatgggaacc
tggatcaaccgtgagatgagaaaactgtacgacagatatctcggaagggtatggagagat
cacaccgaccttgagggtatctggtacggtgttgacaggattccagatgaagaactctgg
caggctcacctgagggcaaagaagagattcatcgagtacataaaagaatcggtaagaaga
agaaacgagagactgggaatcgacgaagatgtgccgaacatcgatgaaaattcgctcatc
ataggttttgcaagaaggtttgccacttacaagagggcagttctcctgctcagcgatctg
gagagactcaagaagatcctcaacgatccagaaagacccgtttacgtggtctatgcgggg
aaggcccatccaagggacgatgcggggaaggaatttttgaaacgcatctacgaagtctcg
cagatgcctgagttcaaaaacaggatcatcgtactggaaaactacgacattggaatggca
cggctcatggtgtcgggagtggatgtgtggctgaacaacccgagaagacccatggaagca
agtggaacaagcggaatgaaggcagcagccaacggagttcttaacgcgagtgtttacgat
ggatggtgggttgaagggtacaacggcagaaacggctgggtcataggcgatgaaagcgtt
cttccagagacggaagtggacgatcccagggacgcagaagcactctacgatctcctcgaa
aacgaaatcatcccaacctactacgaaaacaaagaaaagtggatcttcatgatgaaagag
agcataaagagtgttgctccaagattcagcaccaccagaatgctcaaagaatacacggag
aagttctacataaagggacttgtgaacaaagaatggcttgaaagaaaagaaaacgccgaa
aggtttggtgcatggaaggaaaggatcctcagaaactggagcagcgtttccatagaaaga
atcgtccttgaggacacaaggagtgttgaggtgacggtgaaactgggagacctttcacct
gatgatgtactggttgaacttttgattggaagaggagaaagcatggaagatctggagatc
tggaaggtgatacagataagaaagcacagaagggaaggggatctgttcatctacagttat
gtcaacggtgccctcggtcatcttggctctccgggatggttctacgcggtgagggtgcta
ccttatcatccgaaacttcccaccagattcttgccggagatacctgtggtgtggaaaaag
gttctcgggtga

DBGET integrated database retrieval system