KEGG   Thermotoga neapolitana: CTN_1896Help
Entry
CTN_1896          CDS       T00847                                 

Definition
(GenBank) Bifunctional PGK/TIM
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tna  Thermotoga neapolitana
Pathway
tna00010  Glycolysis / Gluconeogenesis
tna00051  Fructose and mannose metabolism
tna00562  Inositol phosphate metabolism
tna01100  Metabolic pathways
tna01110  Biosynthesis of secondary metabolites
tna01120  Microbial metabolism in diverse environments
tna01130  Biosynthesis of antibiotics
tna01200  Carbon metabolism
tna01230  Biosynthesis of amino acids
Module
tna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tna_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tna00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTN_1896
   00051 Fructose and mannose metabolism
    CTN_1896
   00562 Inositol phosphate metabolism
    CTN_1896
Enzymes [BR:tna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CTN_1896
Exosome [BR:tna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CTN_1896
  Exosomal proteins of bladder cancer cells
   CTN_1896
  Exosomal proteins of melanoma cells
   CTN_1896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACM24072
UniProt: B9KAT9
LinkDB All DBs
Position
complement(1848899..1849654)
Genome map
AA seq 251 aa AA seqDB search
MILAGNWKMHKTISEAKKFVSLLLNELHDVKEFETVVCPPFTALSEVGEILSGRNIKLGA
QNVFYEDQGAFTGEVSPVMLKEIGVEYVIVGHSERRRIFKEDDELINRKIRAVLEKGMTP
IFCVGETLEEREKGLTFCVVEKQVREGLYGLSREEAQKVVIAYEPVWAIGTGKVATPQQA
QEVHAFIRRLLSEMYDDETAETIRILYGGSIKPDNFLGLIVQKDIDGGLVGGASLKESFV
ELARIMKGVIS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
ttgatcctcgctggaaactggaagatgcacaagaccatatctgaggcaaaaaaattcgtg
tcgctccttctgaacgaactgcacgatgtgaaagagttcgaaacagtggtctgtccaccg
ttcaccgcactatccgaagttggagagatcctctcgggtagaaacatcaaactcggtgct
cagaacgtcttctacgaggaccagggggcgttcacaggagaagtgtcaccggtgatgctg
aaagaaatcggcgttgagtacgtgatcgtggggcactccgaaagaaggcgcatcttcaag
gaagacgatgaactgataaacagaaagatcagggctgttctggaaaagggaatgacaccg
atcttctgtgtgggtgaaactctggaggaaagagaaaagggtctcacattctgcgttgtt
gaaaaacaggtaagagaaggactttacggtctcagcagagaggaagcacagaaggtggtc
atagcctacgaacccgtgtgggcgatcggaacaggaaaggtggcaacaccacagcaggct
caggaagtgcatgcgttcataagaaggcttctttctgagatgtacgacgatgaaacggct
gagacgatcaggatactctacggtggtagcataaaaccagacaacttcctcggcctcatc
gttcagaaagacatcgatggtggtctggttggaggagccagtctgaaagaatcctttgtg
gaacttgcaagaataatgaagggagtgatttcctga

DBGET integrated database retrieval system