KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00000721G001
Entry
GSTEN00000721G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00230  Purine metabolism
tng00240  Pyrimidine metabolism
tng00480  Glutathione metabolism
tng00983  Drug metabolism - other enzymes
tng01100  Metabolic pathways
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GSTEN00000721G001
   00240 Pyrimidine metabolism
    GSTEN00000721G001
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GSTEN00000721G001
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    GSTEN00000721G001
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00000721G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tng03400]
    GSTEN00000721G001
Enzymes [BR:tng01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     GSTEN00000721G001
DNA repair and recombination proteins [BR:tng03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    GSTEN00000721G001
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-ProteinID: CAF87761
UniProt: Q4TH71
LinkDB
Position
undetermined
AA seq 441 aa
MLSARAPLSAKNESTLVSDVRQLSLGKENTVSPQQRPLLAPLRESGGPAPLPARRRGCSD
AIAPSLPPAASESELQPRLGVQNGAEDLRRGSDQAGEEEDGAGGGGGAPAEGEPAALRHL
PHPVPGPLADVQEGGGVFLDRRGGRWRLWPPQAGPTPRPLTRSPALAAGGPVQGPAALGV
SEGRREVLHLPRVGLLRRQRRDRQREPGEEPRAGRPPLPGRRASNPMRLARWQVERFTQE
VQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKEPSEREYLFNAIETLPCVKKKADWALN
WIGNQKASTVSARPTLRAAPTRRRPHSLPVLCSRRARGGLCRRGGNLLLGLLCRHLLAEE
ARPDARPDLLQRADQQRRGSALRLRLSDVQAPAAQTVGTDGRRHHQERRGDRAGVPDRAL
PVKLIGMNCQLMKRYIEFVAD
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgctgtccgcccgcgctcccctgtcggccaagaacgagtcgacgctcgtcagcgacgtc
cgccagctgtcgctgggcaaagagaacacggtgagcccccagcagcggcctctgctcgcc
cctctccgggagagcggaggcccggcgccgctcccggcccgccggaggggctgctctgac
gccattgctccgtctctccctcctgcagcctccgagtctgaactccagccgcgtcttggc
gtccaaaacggcgcggaggatcttcgccgaggcagcgaccaagccggggaagaggaggac
ggggcaggaggaggaggaggagcccctgctgaaggagaacccgcggcgcttcgtcatctt
ccccatccagtaccaggacctctggcagatgtacaagaaggcggaggcgtctttctggac
cgccgaggaggtaggtggcgcctctggcccccgcaggcagggccgacgccgcgcccgctc
acccgctcacctgctctggctgcaggtggacctgtccaaggacctgcagcactgggagtc
tctgaaggacgacgagaggttcttcatctcccacgtgttggccttcttcgccgccagcga
cgggatcgtcaacgagaacctggtgaggagcctcgagcgggccgtcctccgctcccgggc
cggcgcgcctccaacccaatgcgtcttgctcgctggcaggtggagcgtttcacccaggag
gtgcaggtgacggaggccaggtgtttctacggtttccagatcgccatggagaacatccac
tcggagatgtacagcctcctgatcgacacctacatcaaggagccgtcggagcgggaatat
ctcttcaacgccatcgagaccctcccctgcgtgaagaagaaggccgactgggcgctcaac
tggatcggcaaccagaaggcctctacggtgagcgcccggcccacgctgcgcgccgcgccc
acccgccggcggccccactcacttcctgtgctctgctccaggagagcgcgtggtggcctt
tgccgccgtggagggaatcttcttctcgggctcctttgccgccatcttctggctgaagaa
gcgaggcctgatgcccggcctgaccttctccaacgagctgatcagcagagacgagggtct
gcactgcgacttcgcctgtctgatgttcaagcacctgctgcacaaaccgtcggcacagac
ggtcggcgccatcatcaggaacgccgtggagatcgagcaggagttcctgaccgagctctg
cccgtcaagctgatcgggatgaactgccagctgatgaagcgctacatcgagtttgtggcc
gac

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00003453G001
Entry
GSTEN00003453G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00230  Purine metabolism
tng00240  Pyrimidine metabolism
tng00480  Glutathione metabolism
tng00983  Drug metabolism - other enzymes
tng01100  Metabolic pathways
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GSTEN00003453G001
   00240 Pyrimidine metabolism
    GSTEN00003453G001
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GSTEN00003453G001
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    GSTEN00003453G001
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00003453G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tng03400]
    GSTEN00003453G001
Enzymes [BR:tng01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     GSTEN00003453G001
DNA repair and recombination proteins [BR:tng03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    GSTEN00003453G001
SSDB
Motif
Pfam: Ribonuc_red_sm PSP1
Other DBs
NCBI-ProteinID: CAF89523
UniProt: Q4TC59
LinkDB
Position
undetermined
AA seq 407 aa
MLSARAPLSAKNEPTLVSDVRQLSLGKENTVSPQQRPLLAPLRESGGPAPLPARRRGCSD
AIAPSLPPAASESELQPRLGVQNGAEDLRRGSVPGPLADVQEGGGVFLDRRGGRWRLWPP
QAGRRRARSPAHLLWLQVDLSKDLQHWESLKDDERFFISHVLAFFAASDGIVNENLVERF
TQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKEPSEREYLFNAIETLPCVKKKADW
ALNWIGNQKASYGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLH
CDFACLMFKHLLHKPSAQTVGAIIRNAVEIEQEFLTEALPVKLIGMNCQLMKRYIEFIYR
AENPFDFMENISLEGKTNFFEKRVGEYQRMGVMAGAADNTFRLDADF
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgctgtccgcccgcgctcccctgtcggccaagaacgagccgacgctcgtcagcgacgtc
cgccagctgtcgctgggcaaagagaacacggtgagcccccagcagcggcctctgctcgcc
cctctccgggagagcggaggcccggcgccgctcccggcccgccggaggggctgctctgac
gccattgctccgtctctccctcctgcagcctccgagtctgaactccagccgcgtcttggc
gtccaaaacggcgcggaggatcttcgccgaggcagcgtaccaggacctctggcagatgta
caagaaggcggaggcgtctttctggaccgccgaggaggtaggtggcgcctctggcccccg
caggcaggccgacgccgcgcccgctcacccgctcacctgctctggctgcaggtggacctg
tccaaggacctgcagcactgggagtctctgaaggacgacgagaggttcttcatctcccac
gtgttggccttcttcgccgccagcgacgggatcgtcaacgagaacctggtggagcgtttc
acccaggaggtgcaggtgacggaggccaggtgtttctacggtttccagatcgccatggag
aacatccactcggagatgtacagcctcctgatcgacacctacatcaaggagccgtcggag
cgggaatatctcttcaacgccatcgagaccctcccctgcgtgaagaagaaggccgactgg
gcgctcaactggatcggcaaccagaaggcctcctacggagagcgcgtggtggcctttgcc
gccgtggagggaatcttcttctcgggctcctttgccgccatcttctggctgaagaagcga
ggcctgatgcccggcctgaccttctccaacgagctgatcagcagagacgagggtctgcac
tgcgacttcgcctgtctgatgttcaagcacctgctgcacaaaccgtcggcacagacggtc
ggcgccatcatcaggaacgccgtggagatcgagcaggagttcctgaccgaggctctgccc
gtcaagctgatcgggatgaactgccagctgatgaagcgctacatcgagtttatctaccgg
gccgagaaccctttcgacttcatggagaacatctctctggaggggaagaccaacttcttt
gagaagagagtgggcgagtaccagcgcatgggcgtgatggcgggcgccgccgacaacacc
ttcaggctggacgccgacttctga

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00003455G001
Entry
GSTEN00003455G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00230  Purine metabolism
tng00240  Pyrimidine metabolism
tng00480  Glutathione metabolism
tng00983  Drug metabolism - other enzymes
tng01100  Metabolic pathways
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GSTEN00003455G001
   00240 Pyrimidine metabolism
    GSTEN00003455G001
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GSTEN00003455G001
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    GSTEN00003455G001
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00003455G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tng03400]
    GSTEN00003455G001
Enzymes [BR:tng01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     GSTEN00003455G001
DNA repair and recombination proteins [BR:tng03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    GSTEN00003455G001
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-ProteinID: CAF89525
UniProt: Q4TC57
LinkDB
Position
undetermined
AA seq 198 aa
MLRARWPRPPHRWKKADWALNWIGNQKASYGERVVAFAAVEGIFFSGSFAAIFWLKKRGL
MPGLTFSNELISRDEGLHCDFACLMFKHLLHKPSAQTVGAIIRNAVEIEQEFLTEALPVK
LIGMNCQLMKRYIEFVADRLLLELGFAKIYRAENPFDFMENISLEGKTNFFEKRVGEYQR
MGVMAGAADNTFRLDADF
NT seq 597 nt   +upstreamnt  +downstreamnt
atgctcagggcccgctggccccgccccccacacaggtggaagaaggccgactgggcgctc
aactggatcggcaaccagaaggcctcctacggagagcgcgtggtggcctttgccgccgtg
gagggaatcttcttctcgggctcctttgccgccatcttctggctgaagaagcgaggcctg
atgcccggcctgaccttctccaacgagctgatcagcagagacgagggtctgcactgcgac
ttcgcctgtctgatgttcaagcacctgctgcacaaaccgtcggcacagacggtcggcgcc
atcatcaggaacgccgtggagatcgagcaggagttcctgaccgaggctctgcccgtcaag
ctgatcgggatgaactgccagctgatgaagcgctacatcgagtttgtggccgaccgcctg
ctgctggagctgggcttcgctaagatctaccgggccgagaaccctttcgacttcatggag
aacatctctctggaggggaagaccaacttctttgagaagagagtgggcgagtaccagcgc
atgggcgtgatggcgggcgccgccgacaacaccttcaggctggacgccgacttctga

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00003458G001
Entry
GSTEN00003458G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00230  Purine metabolism
tng00240  Pyrimidine metabolism
tng00480  Glutathione metabolism
tng00983  Drug metabolism - other enzymes
tng01100  Metabolic pathways
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GSTEN00003458G001
   00240 Pyrimidine metabolism
    GSTEN00003458G001
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GSTEN00003458G001
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    GSTEN00003458G001
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00003458G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tng03400]
    GSTEN00003458G001
Enzymes [BR:tng01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     GSTEN00003458G001
DNA repair and recombination proteins [BR:tng03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    GSTEN00003458G001
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-ProteinID: CAF89527
UniProt: Q4TC55
LinkDB
Position
undetermined
AA seq 369 aa
EEPLLKENPRRFVIFPIQYQDLWQMYKKAEASFWTAEEVDLSKDLQHWESLKDDERFFIS
HVLAFFAASDGIVNENLVERFTQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKEPS
EREYLFNAIETLPCVKKKADWALNWIGNQKASYGERPAHAGAPRPRPRRRQPHSLPVLCS
RRARGGLCRRGGNLLLGLLCRHLLAEEARPDARPDLLQRADQQRRGSALRLRLSDVQAPA
AQTVGTDGRRHHQERRGDRAGVPDRGSARQADRDELPADEALHRVCGRPPAAGAGFAKTG
GGAETRRGRGSGSPVASVQIYRAENPFDFMENISLEGKTNFFEKRVGEYQRMGVMAGAAD
NTFRLDADF
NT seq 1107 nt   +upstreamnt  +downstreamnt
gaggagcccctgctgaaggagaacccgcggcgcttcgtcatcttccccatccagtaccag
gacctctggcagatgtacaagaaggcggaggcgtctttctggaccgccgaggaggtggac
ctgtccaaggacctgcagcactgggagtctctgaaggacgacgagaggttcttcatctcc
cacgtgttggccttcttcgccgccagcgacgggatcgtcaacgagaacctggtggagcgt
ttcacccaggaggtgcaggtgacggaggccaggtgtttctacggtttccagatcgccatg
gagaacatccactcggagatgtacagcctcctgatcgacacctacatcaaggagccgtcg
gagcgggaatatctcttcaacgccatcgagaccctcccctgcgtgaagaagaaggccgac
tgggcgctcaactggatcggcaaccagaaggcctcctacggtgagcgcccggcccacgct
ggcgcgccgcgcccacgcccacgccgccgccagccccactcacttcctgtgctctgctcc
aggagagcgcgtggtggcctttgccgccgtggagggaatcttcttctcgggctcctttgc
cgccatcttctggctgaagaagcgaggcctgatgcccggcctgaccttctccaacgagct
gatcagcagagacgagggtctgcactgcgacttcgcctgtctgatgttcaagcacctgct
gcacaaaccgtcggcacagacggtcggcgccatcatcaggaacgccgtggagatcgagca
ggagttcctgaccgaggctctgcccgtcaagctgatcgggatgaactgccagctgatgaa
gcgctacatcgagtttgtggccgaccgcctgctgctggagctggcttcgctaagacgggc
ggcggcgcagaaactcgccgggggcggggctcgggctcacctgtggcctccgtgcagatc
taccgggccgagaaccctttcgacttcatggagaacatctctctggaggggaagaccaac
ttctttgagaagagagtgggcgagtaccagcgcatgggcgtgatggcgggcgccgccgac
aacaccttcaggctggacgccgacttc

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00012923G001
Entry
GSTEN00012923G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00230  Purine metabolism
tng00240  Pyrimidine metabolism
tng00480  Glutathione metabolism
tng00983  Drug metabolism - other enzymes
tng01100  Metabolic pathways
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GSTEN00012923G001
   00240 Pyrimidine metabolism
    GSTEN00012923G001
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GSTEN00012923G001
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    GSTEN00012923G001
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00012923G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tng03400]
    GSTEN00012923G001
Enzymes [BR:tng01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     GSTEN00012923G001
DNA repair and recombination proteins [BR:tng03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    GSTEN00012923G001
SSDB
Motif
Pfam: Ribonuc_red_sm DUF249
Other DBs
NCBI-ProteinID: CAF96041
UniProt: Q4STJ1
LinkDB
Position
21
AA seq 352 aa
GTEGEPLLQENPRRFVIFPIQYPDIWKMYKQAQASFWTVEEVDLSKDLAHWDSLKPEEKH
FISHVLAFFAASDGIVNENLVQRFCQEVQVPEARSFYSYQVLIESVHSEMYSLLINTYIR
DLKEREHLFNAIYTMPCVKRKADWALQWINDSTSTFGERLVAFAAVEGIFFSGSFASIYW
LKKRGLMPGLTYSNELISRDEGLHCTFACLLYSYLVKKPSEDRVKDIITKAVSIEQVGGS
YRSMDGNKPNREVLIKDATCFCLQEFLTEALPVDLIGMNRCLMKQYIEFVADRLFADLGL
AKMYNAENPFDFMEAISLEGKTNFFEKRVAEYQRFGIMSSPVDSEFTLDADF
NT seq 1059 nt   +upstreamnt  +downstreamnt
gggacggagggtgaacctttgctccaggagaaccccagacgcttcgtcatcttccccatc
cagtaccctgacatctggaagatgtacaagcaggcccaggcctccttctggacggtggaa
gaggtggacttgtccaaagacttggcccactgggacagtttaaaacctgaggagaaacac
ttcatctcacacgtcttggccttcttcgccgccagcgacggcatcgtcaacgagaacctg
gtgcagaggttctgccaggaggtgcaggttcctgaagcgcgctccttctacagctaccag
gtcctcatcgagtcggtgcattcagagatgtacagcctgctcatcaacacctacatcagg
gatctgaaggaaagggaacatttattcaacgccatttacaccatgccctgtgtgaagaga
aaggccgactgggcgctccagtggatcaatgacagcacgtccacctttggggagcggctg
gtggcatttgcggcggtggagggcatcttcttctccggctccttcgcttccatctactgg
ctgaagaaaagaggactcatgccaggcctgacgtattcaaacgagctgatcagcagggac
gagggcctgcactgtacatttgcgtgcctgctgtacagctacctggtgaagaagccgtcg
gaggacagagtcaaggacatcatcactaaagccgtcagcatcgagcaggtcggtgggagc
taccgttccatggacgggaacaaaccaaacagggaagtcttgatcaaagatgcgacgtgt
ttctgcttgcaggagtttctgacggaggccttgcctgtggatttgattggaatgaaccgt
tgcctgatgaaacagtacatcgagtttgtggccgaccgccttttcgccgacctcgggctg
gccaagatgtacaatgcggagaatccatttgacttcatggaggccatttccctggagggg
aaaaccaacttctttgagaaacgagttgcagaatatcaacgtttcgggatcatgtcaagc
cccgtggactctgaatttacactggatgcagacttctga

DBGET integrated database retrieval system