KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00001048G001
Entry
GSTEN00001048G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10133  tumor protein p53-inducible protein 3 [EC:1.-.-.-]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00001048G001
Enzymes [BR:tng01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     GSTEN00001048G001
SSDB
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N ADH_N_2
Other DBs
NCBI-ProteinID: CAF87970
UniProt: Q4TGL2
LinkDB
Position
undetermined
AA seq 326 aa
MRAVCIDTPGRPENLYLKSVPRPQPKVGEALVKIHATALNRADLLQRRGLYPPPPGESDI
MGLEVAGTVAALGPGAKKGWKLGDRVMALLCGGGYAEYVAVPEELLMPVPPNLSLCQAAA
IPEVWLTAFQLLAFIAQVQPGEVVLAHAGASGVGTAAVQLVRLFGAVPVVTAGSPEKLKM
AENLGAAAGFNYREGSFAQRVHDFTGGKGVNIILDCIGGHIWEQNVSCLATDGRWVLYGT
IGGRAVEGNLLGNLLSKRGHLLSSLLRSRSLQYKAELVTAFSHKVLPHFSGSLRPVIDST
FNLENIADAHRHMEANRNTGKIVINV
NT seq 978 nt   +upstreamnt  +downstreamnt
atgcgggcagtgtgtatagacacaccaggaagaccagagaatttatacttaaaaagtgtg
cccagacctcaacctaaagtgggagaagccctagttaaaattcatgcaacggccctaaac
agagctgacttactgcagaggcgaggcctgtacccaccccctccaggagaaagcgacatc
atgggactggaggtggcgggcactgtggccgctctgggcccgggggctaaaaaaggctgg
aagctgggtgacagggtcatggcactgctgtgtgggggaggatatgcagaatatgttgca
gtgcctgaggagcttctcatgccggttcccccgaaccttagtctctgccaggctgctgcc
atcccagaggtctggctcacagcgttccaactgctggctttcatcgctcaggtgcagcca
ggtgaagtagtgctggctcacgccggagccagcggggttggaacagctgccgttcagctg
gttcgcctgtttggggccgtgcccgtcgtcaccgcagggagtccagaaaagctgaagatg
gccgagaacctgggagcggcggctggattcaactacagagagggaagctttgcgcagagg
gttcatgacttcaccggaggtaaaggtgtgaacattatccttgactgcattggaggacat
atttgggagcaaaatgtcagctgtttggccaccgacgggagatgggtgctgtatggcacc
ataggcggcagggcagtagagggaaatctgctgggcaacctgctgtcaaagcgaggtcac
ctgctcagcagcctcctgcgctctcgcagccttcagtacaaagcagaactggtgacggca
ttctcgcacaaggtcttaccacatttctcagggtctttgaggccagtgattgacagcaca
ttcaatctggagaacattgcagatgctcacagacacatggaagccaacagaaacacagga
aagattgttattaatgtg

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00004275G001
Entry
GSTEN00004275G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10134  etoposide-induced 2.4 mRNA
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00004275G001
SSDB
Motif
Pfam: EI24
Other DBs
NCBI-ProteinID: CAF90156
UniProt: Q4TAC6
LinkDB
Position
undetermined
AA seq 334 aa
MTDSIRAFLRNVATGIKDSILGIGTISKLDARIQQKREEQRKRRVSGALAQRRAQSEERK
LDVEPKVASRILQCCAWNGGVFWLSLFLFYRVFIPVLQALTAKIIGDPSLHGSIWSWLEF
ILTSVFSALWVLPLFVLSKIVNAIWFQDIADLAFEVSGCKGQPFPSISKIIADMLFNLLL
QALFLIQGMIVSLFPIDAIGQTISLLHMSLLYSLYCFEYRWFNHGIEMHQRLSNIERNWP
YYFGFGLPMAMLTALPSSYIISGCLFSILFPLFIISANEAKTPTKLYHFQLRLFSLVVLI
SNKLFHKTVNLQSALMSSASSERLSSPNNSPTRN
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgacagacagcatcagggctttccttcgtaatgttgcaacgggaatcaaggattctata
ctggggattggaactatttccaaactggatgctcgcattcaacagaagagggaagagcag
cgcaagagaagggtcagtggggccctagcgcaacgaagggcacagagtgaggaacgcaaa
ctagatgttgaacctaaggtagctagcaggatattgcagtgctgtgcttggaatggagga
gtgttttggctaagtctttttctcttctaccgagtgtttattccagtgctgcaagctctt
acagcaaaaattattggtgacccctccctccatggcagtatttggtcctggttagaattt
atattgacttctgtcttcagtgctctttgggttctcccattgtttgtcctcagcaagatt
gtcaatgcaatctggttccaggatatagctgatttagcctttgaggtttctggatgtaag
ggacaaccattccccagcatcagtaaaatcatcgcagacatgttgtttaaccttctcctc
caggcattatttctcattcagggtatgatcgttagccttttcccaatcgacgccattgga
cagaccattagccttctccacatgtctctgctctactctctgtattgcttcgagtatcgc
tggtttaaccatggaattgagatgcatcaacgactgtccaatattgagagaaactggcca
tattattttggttttggtttgcctatggctatgctgactgcacttccttcgtcatacatc
attagtggttgcttgttctctatcctgtttcctctgttcatcatcagtgcaaatgaagcc
aagactccaacaaaactgtaccacttccagctgcggctcttctcactggttgtactcatc
agcaataagcttttccacaagacagtcaatctacagtctgccctaatgtcctctgcttcc
tcagaaagactgtcctcccctaacaactcaccaacccgcaac

DBGET integrated database retrieval system