KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00002716G001
Entry
GSTEN00002716G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10136  TP53 apoptosis effector
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00002716G001
SSDB
Motif
Pfam: PMP22_Claudin Claudin_3 Clc-like CrgA DUF1616 Claudin_2
Other DBs
NCBI-ProteinID: CAF89007
UniProt: Q4TDM5
LinkDB
Position
undetermined
AA seq 112 aa
MFRCGIAYPRCRWILPLLLLFAIIFDIIAIAATSGWVEDEDAKTHYTNMWDEYRGRNGQW
ESASLMQYAWAKAVAALMIIGLLVLIVAFIVSCVALCCSLNIPLLPLVGVLL
NT seq 336 nt   +upstreamnt  +downstreamnt
atgtttcgctgcgggatagcctacccccgctgcaggtggatcctgcctctgctgctgctc
ttcgccattatttttgacatcatcgccatcgccgccacctccggatgggtcgaggacgag
gacgcgaagacccactacaccaatatgtgggacgagtaccgaggcaggaacggccagtgg
gagtctgcgtccctcatgcagtacgcctgggccaaagccgtggccgcgctgatgatcatc
ggcctcctcgtcctcatcgtggccttcatcgtctcctgcgtggcgctctgctgctcgctc
aacatccccctgctgcccttggtgggagtgctgctg

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00014357G001
Entry
GSTEN00014357G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10136  TP53 apoptosis effector
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00014357G001
SSDB
Motif
Pfam: PMP22_Claudin Claudin_3 Clc-like Claudin_2 EBP Amastin
Other DBs
NCBI-ProteinID: CAF97097
UniProt: Q4SQI5
LinkDB
Position
17
AA seq 185 aa
MFRCGIAYPRCRWILPLLLLFAIIFDIIAIAATSGWVEDEDAKTHYTNMWDEYRGRNGQW
ESASLMQYAWAKAVAALMIIGLLVLIVAFIVSCVALCCSLNIPLLPLVGVLLIVVVVFQV
IALIIYPVKFNELIYEGHYYYTWAYGFGWGATILCIGCAILFCCLPNYEDHLTGLAKTKY
IYSSA
NT seq 558 nt   +upstreamnt  +downstreamnt
atgtttcgctgcgggatagcctacccccgctgcaggtggatcctgcctctgctgctgctc
ttcgccattatttttgacatcatcgccatcgccgccacctccggatgggtcgaggacgag
gacgcgaagacccactacaccaatatgtgggacgagtaccgaggcaggaacggccagtgg
gagtctgcgtccctcatgcagtacgcctgggccaaagccgtggccgcgctgatgatcatc
ggcctcctcgtcctcatcgtggccttcatcgtctcctgcgtggcgctctgctgctcgctc
aacatccccctgctgcccttggtgggagtgctgctgatcgttgtcgtggtcttccaggtc
atcgctctcatcatctacccggtcaagttcaacgagctgatctacgagggccactactac
tacacctgggcgtacggcttcggctggggcgccaccatcctctgcatcggctgcgccatc
ctcttctgctgcctgccgaactacgaggaccatctgactggcctcgccaagaccaagtac
atctactcctccgcctaa

DBGET integrated database retrieval system