KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00003787G001
Entry
GSTEN00003787G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K03982  plasminogen activator inhibitor 1
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
tng04218  Cellular senescence
tng04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    GSTEN00003787G001
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00003787G001
   04218 Cellular senescence
    GSTEN00003787G001
Peptidases and inhibitors [BR:tng01002]
 Peptidase inhibitors
  Family I4: serpin family
   GSTEN00003787G001
Exosome [BR:tng04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GSTEN00003787G001
Glycosaminoglycan binding proteins [BR:tng00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   GSTEN00003787G001
SSDB
Motif
Pfam: Serpin Ntox15
Other DBs
NCBI-ProteinID: CAF89782
UniProt: Q4TBF0
LinkDB
Position
undetermined
AA seq 330 aa
PYGAVSVIAMAQLGAAGKTLRALDSAMGYSLLARGMSRQQRLLQRDLSSEEGVETASAAM
VERKMSLEKGYRRALVKAFQTHPHQVDFTKPEQAVNIINEWVSDHTAGAIPDFLASGSLT
DETRLVLLNALSFQALWKVPFDPKQTAERMFHCANGSVVPVHMMTLTNYFHYGEFVTTEG
IDYSVIEVPYDGDTLSMLLASPIESDVPLDKVIADLSSKRIHQWRQELRRVKRQLSMPRF
TFNSEVDFKSALLKMGLGDVFNMATADFTRITTDEQLCVSKIMQKIKIEVNEHGTKASAA
SAAVMFSRMAVEEIALDRPFLFLIQHKPTG
NT seq 990 nt   +upstreamnt  +downstreamnt
ccatacggcgcagtctccgttatcgccatggctcagctaggcgctgctgggaaaaccctc
agagctctagattcagccatgggctattccctgcttgcacgtggaatgtcaagacagcag
cgtctcctgcagcgagacctttctagtgaagagggagtggagacagccagtgcagcgatg
gtggagaggaagatgagtctggagaaaggataccgccgagccctggtcaaggcctttcag
acacatccacaccaagttgacttcacaaagccagagcaggccgtcaacatcatcaacgaa
tgggtttcagatcacaccgccggtgccatccctgacttcttggcatctggatccctgacg
gacgagacccgcctggttctcctcaatgctctctccttccaagctctttggaaagtgccc
tttgaccctaagcaaacagcagaaaggatgttccactgtgcaaacggaagcgtagtgccc
gtgcacatgatgaccctcacaaactatttccactacggtgagtttgtgaccaccgaaggc
atcgactatagcgtcatcgaggtaccgtacgacggcgacacactgtctatgctcctggca
tcacccattgagtccgacgtgccactggacaaggtgattgccgacctaagcagcaagagg
atccaccagtggaggcaggagttgcggagggtcaaaaggcaactgtccatgccaaggttc
actttcaactctgaggtcgatttcaaaagtgctttgctcaaaatgggcttgggagatgtt
ttcaacatggcaactgccgacttcacaagaatcactactgacgagcaactatgcgtgtca
aagattatgcagaaaatcaagatagaggtcaatgagcacggcaccaaagcttcagcagcg
agtgctgccgtgatgttctctcgcatggcagtggaggagatcgcccttgacagacccttc
ctcttcctgattcaacacaagcccacaggt

DBGET integrated database retrieval system