KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00004219G001
Entry
GSTEN00004219G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04141  Protein processing in endoplasmic reticulum
tng04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:tng00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    GSTEN00004219G001
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    GSTEN00004219G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tng03000]
    GSTEN00004219G001
Transcription factors [BR:tng03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    GSTEN00004219G001
SSDB
Motif
Pfam: bZIP_1 bZIP_2 YabA bZIP_Maf CENP-H ATP-synt_B DUF4140
Other DBs
NCBI-ProteinID: CAF90118
UniProt: Q4TAG4
LinkDB
Position
undetermined
AA seq 522 aa
MMGSCFRRRRWEDDACLYQCESIEDGEDGDGSRGLKYEPLFDHDLVLTLDPDNPTSPWQH
LADPLAVFQVKAEPASPTPSSASDCSASSPEPQVKPPRPSSCLLRLLTFDLCVQIVVKSE
NPPTPPYMYGDVLSPPLGSMEVTIATSAVPSPQRTEVPPVLGGVQSPAGGPPGAARLKAS
SILSSKPPIQPRPVCVPPVPLGQSAAAARGLVLGGVRPGGQSQPAPALVKVEPAAPSGPQ
HASGTSSPSAAKPIVPALLKASVGSGSGDIDVSLLLPARSVQQKGSPGTFCRPGDLAQEA
AHPSVWLPLQMKVLKRQQRMIKNRESACQSRKKKKEYLQNLEAQLREAQQENQRLRRENQ
ELRQRLAGKEHLGQESGGPAGGRGLLHGAPPAGDGAAAGDGGTSSQGGGEVGDGRGGRGG
ASRVLPVQEPERGAERHEGPGAAGHRPLLHLLRLQAVQPLRVPQVGPAAPAAPAAPAAPA
GSGLLLCSSGWRMSSVVGSRGTRSTGRSQEERASWPRRPRWP
NT seq 1568 nt   +upstreamnt  +downstreamnt
atgatgggcagctgcttccgaaggaggcggtgggaggacgatgcatgtctgtaccagtgc
gagagcatcgaggacggggaggacggagacggcagccgaggcctcaagtacgagccgctg
tttgaccatgaccttgttcttacgctggatcctgacaaccccacatcgccatggcaacac
ctagccgacccactcgcagtgtttcaggtgaaagcagaaccggcctccccgacgccgtcc
tcggcctctgactgctcggcctcgtctccggagccacaggtgaagccgccgcgcccgtcc
tcctgcctgctccgcctcctcacctttgacctttgtgtccagatcgtggtgaagagtgag
aacccccccacgcctccctacatgtacggagatgtgctgtcgccgccgctggggtcgatg
gaggtcaccatcgccacgtcagcggtgccgtcccctcagaggaccgaggtcccgcccgtc
ctgggtggagtccagagcccggctggaggtcccccgggggcggccaggctgaaggccagc
agcatcctgagcagcaaaccgcccatccagcccagacccgtgtgtgtgcccccggtcccg
ctgggccagagtgctgcagcagccaggggcctggtcctggggggggtgcgcccggggggg
cagagccagcccgctccagccctggtcaaagtggagcccgcggcccccagcggcccccag
cacgcctcgggcaccagctccccgtcggcagccaagcccatcgtcccggcgctgctcaag
gcctccgtcggcagcggctccggcgacatcgacgtgagtctgctgctcccggctcggtcg
gtccagcagaaaggttccccggggaccttctgccgacctggggacctggcccaggaggca
gctcacccgagcgtctggctccctctgcagatgaaggtcctgaagcgccagcagaggatg
atcaagaaccgcgagtcggcctgccagtccaggaagaagaagaaggagtacctgcagaac
ctggaggcccagctcagggaggcccagcaggagaaccagcgtctgcgcagggagaaccag
gagctgaggcagagactggcggggaaggagcatctcggacaggagagcggcggacctgca
ggagggcgtggtctcctacacggggcgccacctgctggagatggagcagcagcaggagac
ggcggcacctcctcacaggggggaggagaagtcggagacggacgaggagggaggggagga
gcttcccgagtccttccagttcaggaacctgagcgaggtgctgagcgacatgaaggacct
ggtgctgcaggacatcgaccgctacttcacctcctccgactgcaggcagttcaaccgctc
cgagtccctcaggttggtcctgctgctcctgctgctcctgctgctcctgctgctcctgct
ggctcagggctgctcctgtgctcctcaggctggcggatgagctccgtggttgggtccaga
ggcaccagatcgaccggaagaagtcaggaggaaagagcaagctggccaagaaggccaaga
tggcccag

DBGET integrated database retrieval system