KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00004609G001
Entry
GSTEN00004609G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10146  cyclin G2
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04068  FoxO signaling pathway
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    GSTEN00004609G001
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00004609G001
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-ProteinID: CAF90359
UniProt: Q4T9S3
LinkDB
Position
undetermined
AA seq 369 aa
HARGMDAFKLMKELRLNYEQEVHYLPKKTGLSLIASSVQDDGRISAKCRDARVEDLWSLT
SFFGYSTQTFVLAVNLLDRFLAMMRVRPSLLEHEQSPAVLFSSHVTPFSAFLPADPAQAP
VVRQPQLPPHGGQGDGGGVQPHALRRADSHRAVPLHRLGPGAHGEDRRPEAQLQILRRHR
LDLPAPVPPHRAVALGRQEGDSEPGTAGGSAQGLSVSDNLLFSQGRRLTQQLWCLCPGRP
LTSLSACPAAVGPRPGPPEAGHRSRPLGGHAGDSLSHPETSEDRRQRAAAVERARGPVPV
GLRLARVQQARPQAAAVDRVPAHRPEPAQLPERPGAAHHPRGRLGREREVSAAVATIGFI
LTQTADKAT
NT seq 1110 nt   +upstreamnt  +downstreamnt
catgccagagggatggatgccttcaagctgatgaaggagctgaggctgaactacgagcag
gaagtccactacctccccaagaagacggggctgagtctcatcgcctcctccgtgcaggat
gacgggcgcatctcggccaagtgcagggacgcccgtgtggaggacctctggagcctgacc
agcttctttggctacagcacgcagactttcgtcctggccgtcaaccttttggaccgattc
ttggccatgatgagggtccgtccgtccctcctggagcacgaacagagcccggcggttctt
ttctcttcccatgtgaccccgttttctgcgtttctgcctgcagatccagcccaagcacct
gtcgtgcgtcagcctcagctgcctccacatggcggccaaggtgacggaggaggagtgcaa
cctcacgccctccgacgagctgattcgcatcgggcagtgccgcttcaccgcctcggacct
ggagcgcatggagaagatcgtcgcccagaagctcaacttcaaatccttcgccgtcaccgc
cttgaccttcctgcacctgtaccaccgcatcgcgctgtcgcactcggcagacaggaagga
gactctgagcctggaacagctggaggctcagctcaaggcctgtctgtgtcggataacctt
ctctttagccaaggtaggaggctaacgcagcagctctggtgtctctgccctggacgcccg
ctgacgtctctgtccgcgtgtcccgcagccgtcggtcctcgccctggccctcctgaggca
gggcatagaagccgtccgctcggaggacatgctggagatagcctatcacatccagaaaca
tctgaagatcgccgacagcgagctgctgctgtggagcgagcgcgtggcccggtgcctgtc
ggactacgcctcgcccgagtgcagcaagcccgaccacaggcggctgcagtggatcgtgtc
ccggcgcaccgcccagaacctgcacagctaccggaacgtcccggagctgcccaccatccc
cgagggcggctggggcgagagcgagaggtgagcgccgcggtcgctactatcggtttcatt
ctgacgcagacggcggacaaagccacctga

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00006787G001
Entry
GSTEN00006787G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10146  cyclin G2
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04068  FoxO signaling pathway
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    GSTEN00006787G001
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00006787G001
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-ProteinID: CAF91842
UniProt: Q4T5J0
LinkDB
Position
undetermined
AA seq 328 aa
MRDLEAIDSLLLKELKSCCAEECNFLPREAGLKLMESSSMENCRAVSSKCRDGRVEELWG
LTSFFGYSTQTFVHAVNLLDRFLTAMKVKVQPKHLPCIGVCCLHIAAKMVEDDTNVSPIH
ELIRISQSKFTVPDLLRMEKIVTEKLGARPEAVTPLTFLHLLYSAFNSWSVEREELPSIE
SLEGQLKACLCRLVFSKAKPSVLALSLFAQEFSTHQSSQLLRILRAIQRYLKINDSELLL
WKQLVAQCMTEYCSTECNKPNNKKLVWIISKKTAQNLHCSHSSVPGLPTIPEGSWDEIES
EDSSEDMSCGEDSPWGSPGSDAEGAFFP
NT seq 984 nt   +upstreamnt  +downstreamnt
atgagggatcttgaagccattgacagcttgctcctaaaagaacttaagtcatgttgtgca
gaagagtgcaactttctccccagagaagctggcctaaaactgatggagtcgtcctccatg
gagaattgccgcgcggtgtcttcaaaatgcagagatggcagagtggaagaactgtggggc
ctgaccagtttttttggctacagcacccaaacatttgttcatgctgttaatttgctggat
agattcctcactgctatgaaggtaaaggtgcagccgaaacacttgccctgtattggagtc
tgctgcctacacattgctgccaaaatggtggaggatgacaccaatgtctcacccatccat
gaactcatccgcatcagccaaagcaagttcactgtgccggaccttcttcgcatggagaag
attgtcacggagaagctcggtgcaaggcctgaagcagtcacaccgctgacctttctgcac
ctgttatactcggccttcaattcctggtctgttgaaagggaggagctcccaagcattgag
agcctggaaggccagctaaaagcgtgcttatgccggcttgttttctctaaagcaaaaccc
tcggtacttgccctgtccctatttgcacaagagttcagcacacaccagtcaagccaattg
ttgaggattcttcgggcaatccaaagatatctaaagatcaatgacagcgagttgctgctc
tggaaacagcttgtggcccagtgcatgactgagtactgctccacggagtgcaacaagccc
aacaacaaaaagctggtttggatcatatccaagaagacggcacagaatctccattgcagc
cactcgtctgtgcccggcctgccaaccatcccggaggggagctgggatgagattgagagt
gaggactcctctgaggacatgagctgtggggaagacagcccatggggctcgccaggaagt
gatgctgaaggagccttcttcccc

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00017018G001
Entry
GSTEN00017018G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10145  cyclin G1
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00017018G001
SSDB
Motif
Pfam: Cyclin_N DNA_photolyase
Other DBs
NCBI-ProteinID: CAF99065
UniProt: Q4SJW7
LinkDB
Position
1
AA seq 296 aa
MIDTVTEPGAQAFGVQLKALMDLEARYQPKLSGLRLIETSQDNGLRMTTRLRELEVKDLL
SLTRFFGFSSDTFSLAVSLLDRFLSVMKIQPKHLSCVGLCCFYIAVKSSEEEKNVPLAND
LIRISQNRFTVSDMMRMEKIIMEKLHWKVKAPTALHFLHLLHGHIQEQLSPESQKILSLE
RLEAQLKACHCSFVFSKLKPSLLAMALLCYETDEQHDPERSDKVAEVLEGLQKQLNIRDG
DLVCVRELVGKCLAEYATSKCSRPNSRRLRWIISGRTARHLKHSYYKITHLPTIPE
NT seq 888 nt   +upstreamnt  +downstreamnt
atgatcgacacagtgacggaacccggcgctcaggcctttggcgtccagctgaaggccctg
atggatctggaggccagatatcaaccaaagctgagtggcttgaggctcatcgagacctcc
caggacaacggcctcaggatgaccaccagactcagggaactggaggtgaaggacctgctg
tctctgaccaggttctttggcttctcgtcggacaccttttcactggccgtcagcctgttg
gatcgattcctctctgtgatgaagattcaaccaaagcatctgtcctgtgtgggtctgtgc
tgcttctacatcgcagtcaagtcttctgaggaggagaagaacgtgcctctggccaacgac
ctgatccgcatcagtcagaaccgctttactgtgtctgacatgatgaggatggagaagatc
atcatggagaagctccactggaaggtgaaagcccccacggccctccacttcctccacctc
ttacacggccacatccaggagcagctgagcccagaaagccagaagatcttgagcctggag
agactggaggcccagctgaaagcctgtcactgctcctttgtcttctccaaattaaaaccg
tctctgctggccatggctctcttgtgttatgagactgatgaacaacacgaccctgaacgc
agcgacaaggtcgcagaggtcctggaaggtctgcaaaagcagctgaatatcagagatgga
gacctggtttgtgtgcgggagctggtggggaaatgcctggctgagtatgccacctccaag
tgctccaggccaaacagccggaggcttcgctggatcatttcgggaagaacggcacgtcac
ctgaagcacagctactacaagatcactcatcttcccaccatacccgag

DBGET integrated database retrieval system