KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00004705G001
Entry
GSTEN00004705G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04110  Cell cycle
tng04114  Oocyte meiosis
tng04115  p53 signaling pathway
tng04218  Cellular senescence
tng04540  Gap junction
tng04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00004705G001
   04114 Oocyte meiosis
    GSTEN00004705G001
   04115 p53 signaling pathway
    GSTEN00004705G001
   04218 Cellular senescence
    GSTEN00004705G001
  09144 Cellular community - eukaryotes
   04540 Gap junction
    GSTEN00004705G001
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    GSTEN00004705G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tng01001]
    GSTEN00004705G001
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tng03032]
    GSTEN00004705G001
   03036 Chromosome and associated proteins [BR:tng03036]
    GSTEN00004705G001
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tng04147]
    GSTEN00004705G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     GSTEN00004705G001
    2.7.11.23  [RNA-polymerase]-subunit kinase
     GSTEN00004705G001
Protein kinases [BR:tng01001]
 Serine/threonine kinases: CMGC group
  CDK family
   GSTEN00004705G001
DNA replication proteins [BR:tng03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    GSTEN00004705G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    GSTEN00004705G001
Exosome [BR:tng04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GSTEN00004705G001
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Seadorna_VP7
Other DBs
NCBI-ProteinID: CAF90431
UniProt: Q4T9K1
LinkDB
Position
undetermined
AA seq 289 aa
MDDYLKIEKIGEGTYGVVYKGRHKATGQVVAMKKIRLESEEEGVPSTAIREVSLLQELKH
PNVVRLLEVLMHDSRLYLIFEFLSMDLKKYLDSIPSGQYMEPMLVKSYLYQILEGILFCH
CRRILHRDLKPQNLLIDNKGVIKLADFGLARAFGVPVRVYTHEVVTLWYRAPEVLLGSPR
YSTPIDVWSTGTIFAELATKKPLFHGDSEIDQLFRIFRTLGTPNNDVWPDVESLPDYKST
FPKWKSGNLSVKNLDKDALDLLAKMLTYNPPKRISAREAMKHPYFDDLD
NT seq 867 nt   +upstreamnt  +downstreamnt
atggatgactatctgaagatcgagaaaattggtgaaggtacctatggggtggtgtacaag
ggcagacacaaggccacggggcaggtggtggccatgaagaagatccgcctggagagcgag
gaagagggcgttcccagcacggccatcagggaggtgtccctgctgcaggagctgaagcac
cccaacgttgtccggctcctggaggtgctgatgcacgactcccgcctctacctcatcttt
gagtttctgtccatggacctgaagaagtacctggactccatcccctcaggccagtacatg
gagccgatgctggtgaagagctacctctatcagatcctggagggcatcctcttctgccac
tgtcgccggattctccaccgggacctgaagccccagaacctgctgatcgacaacaagggc
gtcatcaaactggctgacttcggcctggctcgggccttcggcgtcccggtcagggtctac
acccacgaggtggtgacgctgtggtaccgcgctcccgaggttctcctggggtccccccgc
tactccacccccattgacgtgtggagcaccgggaccatctttgctgagctggcaaccaaa
aagcctctgtttcatggagactcggagatcgatcagctcttcaggatcttcaggactctg
ggaacgccaaacaatgacgtgtggcctgatgtggagagcttgcctgactacaaaagcacc
tttcccaagtggaaaagtgggaacttgtctgtgaagaacctggacaaggacgccctggac
ctcctggcgaaaatgttgacctacaaccccccgaaaaggatctctgcccgcgaagccatg
aagcatccttattttgacgacctggat

DBGET integrated database retrieval system