KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00004743G001
Entry
GSTEN00004743G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04010  MAPK signaling pathway
tng04068  FoxO signaling pathway
tng04110  Cell cycle
tng04115  p53 signaling pathway
tng04210  Apoptosis
tng04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    GSTEN00004743G001
   04068 FoxO signaling pathway
    GSTEN00004743G001
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00004743G001
   04210 Apoptosis
    GSTEN00004743G001
   04115 p53 signaling pathway
    GSTEN00004743G001
   04218 Cellular senescence
    GSTEN00004743G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     GSTEN00004743G001
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     GSTEN00004743G001
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-ProteinID: CAF90456
UniProt: Q4T9H6
LinkDB
Position
undetermined
AA seq 151 aa
MTLEEGLIQEAERAQRSGKALEEVLVSAKENRAITVGVYECAKVMNVDPDSVSFCVLAMD
EQFQWDVALQIHFTLIQSFCFDNDISIVRVGDVQRLAAIVGGQGAELEDAHCVLITTPAE
GSWEDPSLEKLHVFCEESRRLNDWLPEISLP
NT seq 453 nt   +upstreamnt  +downstreamnt
atgactctggaggaaggtctgatccaggaggcggagcgcgcccagcgcagcggcaaggcc
ctggaggaggtcctggtgtcggccaaggagaaccgcgccatcaccgtcggcgtctacgag
tgcgctaaagtcatgaatgtcgacccggacagcgtgtccttctgcgtcctggccatggac
gagcagttccagtgggacgtggctctgcagatccacttcaccctcatccagtccttctgc
ttcgacaacgacatcagcatcgtcagagtcggcgacgtgcagcgcctggccgccatcgtg
ggcggccagggggccgagctggaggacgctcactgcgtgctcatcacgaccccggccgag
ggctcctgggaggacccgtctctggagaagctgcacgtgttctgcgaggagagccggcgc
ctgaacgactggctgcctgagatcagcctgcca

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00004790G001
Entry
GSTEN00004790G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04010  MAPK signaling pathway
tng04068  FoxO signaling pathway
tng04110  Cell cycle
tng04115  p53 signaling pathway
tng04210  Apoptosis
tng04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    GSTEN00004790G001
   04068 FoxO signaling pathway
    GSTEN00004790G001
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00004790G001
   04210 Apoptosis
    GSTEN00004790G001
   04115 p53 signaling pathway
    GSTEN00004790G001
   04218 Cellular senescence
    GSTEN00004790G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     GSTEN00004790G001
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     GSTEN00004790G001
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-ProteinID: CAF90486
UniProt: Q4T9E6
LinkDB
Position
undetermined
AA seq 155 aa
MTLEDLIGTGHRDKGADPVGRALEELLVAAQRQDCLTLGVYESAKLMNADPDSVVLCVLA
TDAEDEADVALQIHFTLLRAFCCDNHVNILRLRGTARLAQLLDGDAGAEPRDLHCILVTN
PPVRPLQSQALQRVSSFCQESRGRNQWLPSLELQD
NT seq 465 nt   +upstreamnt  +downstreamnt
atgacgctggaagacctgatcggaaccggccaccgggataaaggggcggacccggtgggc
cgggccctggaggagctgctggtggcggcgcagcggcaggactgtctcacgctcggcgtc
tacgagtccgccaagctcatgaacgcggacccggacagcgtggttctgtgcgtgctcgcc
accgacgcggaggacgaggcagacgtggcgctgcagatccacttcacgctgcttcgcgcc
ttctgctgcgacaaccacgtcaacatcctgcggctgcgcggcaccgcgcggctggcccag
ctgctggacggcgacgccggcgccgaaccgcgggacctgcactgcatcctggtcacgaac
ccgccggtgcggccgctgcagtctcaggcgctgcagcgggtcagcagcttctgccaggag
agccgcggccggaaccagtggctgcccagtctggagctgcaggac

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00013393G001
Entry
GSTEN00013393G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04010  MAPK signaling pathway
tng04068  FoxO signaling pathway
tng04110  Cell cycle
tng04115  p53 signaling pathway
tng04210  Apoptosis
tng04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    GSTEN00013393G001
   04068 FoxO signaling pathway
    GSTEN00013393G001
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00013393G001
   04210 Apoptosis
    GSTEN00013393G001
   04115 p53 signaling pathway
    GSTEN00013393G001
   04218 Cellular senescence
    GSTEN00013393G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     GSTEN00013393G001
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     GSTEN00013393G001
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-ProteinID: CAF96384
UniProt: Q4SSJ8
LinkDB
Position
15
AA seq 146 aa
RMDSVARALEEVLTSALPQGCITVGVYEAAKSLNVDPDNVVLCILATDDEDVQDVALQIH
FTLIQAFCCENDINILRVNNTRRLAEILGGGNGKQSGGEPLDLHCVLVTSPHSTSWKDPA
LGKVNRFCRESRCMDQWVPIINLPER
NT seq 438 nt   +upstreamnt  +downstreamnt
aggatggattcagtggccagagctctggaggaagtcctcacctccgccttacctcagggc
tgcattacagtcggagtttatgaggctgcaaaatcgctcaatgtagaccctgataacgtg
gttctgtgcatcctggccaccgatgatgaagatgtccaggacgtggccctgcagatccac
ttcaccctcatccaggcgttctgctgcgagaacgacatcaacatcctgagagtcaacaac
acccggcgcctggctgaaatactgggcggaggaaacgggaagcagagtgggggagaacct
ctggacctccactgtgtccttgtcaccagtccacactccacgtcatggaaggatcccgct
ctgggcaaagtgaaccggttctgcagagaaagccgctgcatggatcagtgggtgcccatc
atcaacctgcccgaacga

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00030892G001
Entry
GSTEN00030892G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04010  MAPK signaling pathway
tng04068  FoxO signaling pathway
tng04110  Cell cycle
tng04115  p53 signaling pathway
tng04210  Apoptosis
tng04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    GSTEN00030892G001
   04068 FoxO signaling pathway
    GSTEN00030892G001
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00030892G001
   04210 Apoptosis
    GSTEN00030892G001
   04115 p53 signaling pathway
    GSTEN00030892G001
   04218 Cellular senescence
    GSTEN00030892G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     GSTEN00030892G001
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     GSTEN00030892G001
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-ProteinID: CAG09562
UniProt: Q4RPX0
LinkDB
Position
12
AA seq 159 aa
MTLEEIRGQEKDMESADRVQSAGAALEELLVAAKKQDYITVGVYESAKVMNVDPDSVAFC
VLATDEEYQCDIALQIHFTLIQAFCFDNDVNVVRVTDIERLADIVGADETGESKDVHCIL
VTSPSANPWKNPALDKLGLFCEESRSVYDWVPTITLPER
NT seq 477 nt   +upstreamnt  +downstreamnt
atgactctggaggagatccgcggacaggagaaggacatggagagcgcagacagggtgcaa
agtgcgggcgcagccctggaggagctgctggtcgccgctaagaagcaggactatatcacg
gtcggcgtctacgaatccgccaaagtcatgaatgttgacccggacagcgtggcgttctgc
gtgctcgccaccgatgaggagtaccagtgcgacatcgccctgcagatccacttcacgctc
atccaggcgttctgcttcgacaacgacgtcaacgtggtgcgcgtcaccgacatcgagcgc
ctggccgacatcgtgggcgcggacgagaccggcgagtccaaagacgtgcactgcattctg
gtcacgagtccaagcgcgaacccgtggaaaaacccggctctggacaagctgggtctgttc
tgcgaggagagccggagcgtgtacgactgggtgcccaccatcaccctcccggagcgc

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00031910G001
Entry
GSTEN00031910G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04010  MAPK signaling pathway
tng04068  FoxO signaling pathway
tng04110  Cell cycle
tng04115  p53 signaling pathway
tng04210  Apoptosis
tng04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    GSTEN00031910G001
   04068 FoxO signaling pathway
    GSTEN00031910G001
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00031910G001
   04210 Apoptosis
    GSTEN00031910G001
   04115 p53 signaling pathway
    GSTEN00031910G001
   04218 Cellular senescence
    GSTEN00031910G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     GSTEN00031910G001
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     GSTEN00031910G001
SSDB
Motif
Pfam: Ribosomal_L7Ae DUF1364 GTP_EFTU
Other DBs
NCBI-ProteinID: CAG10315
UniProt: Q4RMR7
LinkDB
Position
10
AA seq 318 aa
MIPEESFLSVENRMHAVGLALEELLVTAQKQDCLTVGIYESAKLLNADPDSVVLCVLAAD
DADDVALQIHFTLLQSFCCESGLTILRFSPSGPLMPESPGYKKLVTLNDRIHCLVYVVDT
SNSSLLTQKMLDKFDAIRRKANQMGIPQILLMTKVDKACSLVAEDLKTVYQSVYIQKKDA
CCGSGPGGAPSNGSETRLPDRRHLRIGEVLNADPDSVVLCVLAADDADDVALQIHFTLLQ
SFCCESGLTILRVSGLRRLQQLLGSADANRNQEEHRDLNCMLVTNPQADHCRLQEVGTYC
QESRRLDQWVPELVLQER
NT seq 957 nt   +upstreamnt  +downstreamnt
atgattccggaggagagcttcttgtccgtggagaacaggatgcatgctgtgggtctggcc
ctggaggagctcctagtaacggctcagaaacaagactgcctgaccgtcggcatctacgaa
tcggcgaagctcctgaacgcggatcccgacagcgtggtcctctgtgtcctggcggccgac
gatgcggacgacgtggccctgcagatccacttcaccctgctccagtccttctgctgcgag
agcggcctcaccatcctcaggtttagtccttccggacccctcatgccggagtctcctggc
tataagaagctggtgacgctgaacgacaggatccactgcttggtctacgtggtggacacc
agcaactcttcgctcctcacccagaaaatgctggacaagttcgacgccatccgcagaaag
gccaatcagatgggtattcctcagattctgctcatgactaaagtggacaaggcgtgctct
ctggtggcagaagacttgaagaccgtttaccagagtgtttacatccagaagaaggatgca
tgctgtgggtctggccctggaggagctcctagtaacggctcagaaacaagactgcctgac
cgtcggcatctacgaatcggcgaagtcctgaacgcggatcccgacagcgtggtcctctgc
gtcctggcggccgacgatgcggacgacgtggctctgcagatccacttcaccctgctccag
tccttctgctgcgagagcggcctcaccatcctcagggtttcgggcctgaggcggctccag
cagctgctgggcagcgccgacgctaacaggaaccaggaggagcacagagacctgaactgc
atgctggtaacgaacccccaggctgaccactgccggcttcaggaagtaggaacctactgc
caggagagccggcgcctggaccagtgggtgcccgaactggtcctgcaggaacgttga

DBGET integrated database retrieval system