KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00004782G001
Entry
GSTEN00004782G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
tng04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00004782G001
   04218 Cellular senescence
    GSTEN00004782G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tng04131]
    GSTEN00004782G001
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tng04147]
    GSTEN00004782G001
Membrane trafficking [BR:tng04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    GSTEN00004782G001
Exosome [BR:tng04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   GSTEN00004782G001
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP Hamartin
Other DBs
NCBI-ProteinID: CAF90482
UniProt: Q4T9F0
LinkDB
Position
15
AA seq 268 aa
SGAVGPVIKCEPCDAGARLLCKPLPKDCVEKVREPGCGCCVTCALPFGQPCGIYTSRCGS
GLTCQHQPGETKPLQALLEGRGICVNATNKRLTPKPTPPVNELPAENIETQEEERNSTSS
GLQTPDSTHRPMGSPRPPLNPFLPSAKSDVLRREQKRTQSFKMEELPGPLITDQQNFSVE
TEQEPDYGPCRREIESILSGLKITDILNPRGFRIPNCDKKGFYKKKQCRPSKGRKRGFCW
CVDKYGQPLPGFHGKERADAQYYNSETQ
NT seq 807 nt   +upstreamnt  +downstreamnt
tcaggtgcggtcggacccgttatcaaatgcgagccgtgcgacgccggagcccgtcttttg
tgcaagccgttacccaaggactgcgtggaaaaagtccgcgaaccgggctgcggctgctgc
gtgacttgcgcgctgcctttcggtcagccgtgcggcatctacaccagcagatgcggctcc
gggctgacttgtcaacatcagcccggcgagacgaaacctctgcaggctctgctggaggga
cgggggatctgtgtcaacgccaccaataaacgactcacgcccaaaccgacgcctccagtc
aatgaacttccagcagagaatattgagactcaggaggaggagaggaattccaccagctca
ggccttcaaaccccagacagcacccacagacccatgggatccccaagacctccacttaac
ccctttctcccctctgccaagtcagacgtcctcagacgggagcagaagagaacccagagc
tttaaaatggaggagctcccgggaccgctcattaccgaccaacaaaacttctctgtagag
accgaacaggagcctgattatggtccctgtcggagagagatcgaaagcattttgagcggc
ctcaagattacagacattctcaaccccagaggtttccgcataccaaactgtgacaagaaa
ggcttttacaagaaaaagcagtgtcgtccatccaaaggcagaaagcggggcttctgctgg
tgcgtggacaaatacgggcagcccctgccaggtttccacgggaaggagcgagcagacgcc
cagtactacaactccgagacccaatag

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00012277G001
Entry
GSTEN00012277G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
tng04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00012277G001
   04218 Cellular senescence
    GSTEN00012277G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tng04131]
    GSTEN00012277G001
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tng04147]
    GSTEN00012277G001
Membrane trafficking [BR:tng04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    GSTEN00012277G001
Exosome [BR:tng04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   GSTEN00012277G001
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP
Other DBs
NCBI-ProteinID: CAF95568
UniProt: Q4SUW4
LinkDB
Position
undetermined
AA seq 272 aa
MSGPYVLCLAAALATFARLAAPAGPLVRCEPCDPGALLLCKPLPKDCAERVREPGCGCCL
TCALGEGQACGVYTARCGSGLSCQQRPGESRPLQALLEGRGLCSGAAARTLSDVLLQARR
QDTNQVDEGAANSSLSASLDSGGPAEPRVHNQLLQKDQNKKTQSYKVEAVSRRTITDVQN
FSLENKRESEYGPCRREMESILSSLKISDVLNPRGFRIPNCDRKGFYKKKQCRPSKGRRR
GYCWCVDKYGQPLPGLDGMERGETQCYHLENK
NT seq 816 nt   +upstreamnt  +downstreamnt
atgagcgggccctacgtgctgtgcctggccgccgcgctggccaccttcgcccgcctcgcc
gcccccgcggggccgctggtgcgctgcgagccgtgcgaccccggcgcgctgctgctgtgc
aagccgctgccgaaggactgcgccgagcgcgtccgggagccgggctgcggctgctgcctg
acgtgcgcgctcggcgagggccaggcgtgcggggtgtacacggcgcgctgcggctccggg
ctgagctgccagcagcggccgggggagagccgaccgctgcaggcgctgctggagggacgc
gggctctgctccggcgcggcggccaggacgctcagcgacgtcctcctgcaggcgcgaagg
caggacaccaaccaggtggacgagggtgcggccaactccagcctcagcgccagcctggac
agcggcgggccggcggagcccagggtccacaaccagctgctccagaaggaccagaacaag
aagacccagagctacaaggtggaagccgtgtccaggcggaccatcaccgacgtccagaac
ttctccctggagaacaagagggagtctgagtatggaccgtgccggcgggaaatggagagc
atcctgagcagcctgaagatcagcgacgtcctcaaccccagaggcttccgcatccccaac
tgtgacaggaaaggcttctacaagaagaagcagtgccgtccatccaaaggcaggaggcgg
ggctactgctggtgcgtggacaagtacggccagccgctgccgggcttggacgggatggag
cgcggcgagacgcagtgctaccacctggagaacaaa

DBGET integrated database retrieval system