KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00004906G001
Entry
GSTEN00004906G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04010  MAPK signaling pathway
tng04210  Apoptosis
tng04620  Toll-like receptor signaling pathway
tng04621  NOD-like receptor signaling pathway
tng04622  RIG-I-like receptor signaling pathway
tng04623  Cytosolic DNA-sensing pathway
tng04625  C-type lectin receptor signaling pathway
tng04920  Adipocytokine signaling pathway
tng05132  Salmonella infection
tng05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    GSTEN00004906G001
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    GSTEN00004906G001
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    GSTEN00004906G001
   04621 NOD-like receptor signaling pathway
    GSTEN00004906G001
   04622 RIG-I-like receptor signaling pathway
    GSTEN00004906G001
   04623 Cytosolic DNA-sensing pathway
    GSTEN00004906G001
   04625 C-type lectin receptor signaling pathway
    GSTEN00004906G001
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    GSTEN00004906G001
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    GSTEN00004906G001
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    GSTEN00004906G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tng01001]
    GSTEN00004906G001
Protein kinases [BR:tng01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   GSTEN00004906G001
SSDB
Motif
Pfam: CC2-LZ zf_C2H2_10 SlyX DUF2043
Other DBs
NCBI-ProteinID: CAF90572
UniProt: Q4T960
LinkDB
Position
undetermined
AA seq 297 aa
QLAKDCEALKAQATSLLAELNERQSCLDKSEHERQLLEEKLCSKTKALQGAERELEQQRK
QHHVAMDKLLLQTQNLEQALKTERHVVTEEKKKLTQLQHAYTCLFKDYDSKLKNELQGGD
LCSRLEEAERALALKQDLIDKLKEEVERQKGSLETVPVLTAQAEIYKADFLAEREAREKL
NQKKEELQDQLTQALADIDRLKQEATSRACMEKMKLRHQDEYQRRRGHMPRPAGMFPGAP
PFNTVPPASSFRNPGLVPVGDPGVGRAEELPDLCCPKCQYQAPDMDTLQIHVMDCIQ
NT seq 894 nt   +upstreamnt  +downstreamnt
cagctggctaaagactgtgaggctctgaaggctcaagcaacatctctgttagcagaactc
aacgagaggcagagctgcctggacaaaagcgaacatgaacgtcagctcctggaggagaag
ctctgcagtaagaccaaagccctgcagggggcggagcgggagctggagcagcagaggaag
cagcatcacgtggccatggacaagctgctgctgcagacccagaacctggagcaggccctg
aagacggagagacacgtggtgacggaggagaagaagaagctgacccagctgcagcacgcc
tacacctgtctgttcaaagactacgactccaaactgaagaacgagctgcaggggggggac
ctgtgcagccgcctggaggaggcggagcgagctctggccctgaagcaggacctgatcgat
aagctgaaggaggaggtggagcgccagaagggttctctggagacggttcccgtcctcact
gcacaggcggagatctataaggcagatttcctggccgagagagaagccagagagaagcta
aaccagaagaaggaggagcttcaggaccagctgacccaggccctggccgacatcgaccgg
ctcaagcaggaagccacatctcgagcttgtatggagaaaatgaagctgaggcaccaggac
gagtaccagcgcagacggggacacatgccccggccagcaggcatgttccccggggctccg
cccttcaacacggtgccccccgcctcctcctttcgtaatccaggtctggtgccggtgggc
gacccgggggtgggccgagccgaggagctgccggatctgtgctgccccaagtgccagtac
caggcccccgacatggacacgctccagatacacgtgatggactgcatccagtag

DBGET integrated database retrieval system