KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00005207G001
Entry
GSTEN00005207G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K06509  CD82 antigen
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00005207G001
Exosome [BR:tng04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GSTEN00005207G001
  Exosomal proteins of other body fluids (saliva and urine)
   GSTEN00005207G001
  Exosomal proteins of colorectal cancer cells
   GSTEN00005207G001
CD molecules [BR:tng04090]
 Proteins
  GSTEN00005207G001
SSDB
Motif
Pfam: Tetraspanin DUF2981 DUF460
Other DBs
NCBI-ProteinID: CAF90792
UniProt: Q4T8J0
LinkDB
Position
undetermined
AA seq 255 aa
MGNGCVTATKYFLFLLNFIFFLCGAVIVGFGLWLLLDNQSFIVVLSDSTAVKTACYILIG
VGAFSMLLGFLGCLGAIYEVRCLLGLYFACLLLILLAQITAGTLIYFQKDALHEETFKVI
GTVLDGYPGNNSSVMQAWDFIQRTMECCGWTSQQDWSGNMIIKNSSMLLFPCSCQNISTA
AGNASDSGFCEAPTPDWPVYEAGCAASVERWVLTNIGVVLGICVGVAVIELLGMVLSICL
CKNIHREDYSKVPKY
NT seq 765 nt   +upstreamnt  +downstreamnt
atgggcaacggctgcgtgacggcaaccaagtacttcctgttcctgctcaacttcatcttc
ttcctctgtggtgctgtcatcgtgggattcggactctggctcctcctggacaatcagagc
ttcatcgtggttctcagcgactccacggccgtgaagacggcctgctacatcctgatcggc
gtgggcgccttctccatgctcctgggcttcctcggctgcttgggggccatttacgaggtc
cgctgcctgctgggcctgtacttcgcctgcctgctgctcatcctcctggctcagatcacc
gccggcaccctcatctacttccagaaggacgcgttacacgaggaaaccttcaaggtcatc
ggcacagtgctggatggttaccctggcaacaactcctcggtgatgcaggcctgggacttc
atccagaggaccatggagtgttgcggctggaccagccagcaggactggagcgggaacatg
atcatcaagaacagctccatgctgctcttcccctgctcctgccagaacatctccacggcc
gccggaaacgcctccgacagcggcttctgtgaggccccgacgcccgactggcccgtctat
gaggcgggttgtgccgccagcgtggagcgttgggtcctcaccaacatcggggtggtgctg
ggaatctgcgtgggcgtggctgtgatcgagctgctggggatggtcctgtccatctgcctg
tgcaagaacatccacagggaggactacagcaaagtgcccaagtac

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00005209G001
Entry
GSTEN00005209G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K06509  CD82 antigen
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00005209G001
Exosome [BR:tng04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GSTEN00005209G001
  Exosomal proteins of other body fluids (saliva and urine)
   GSTEN00005209G001
  Exosomal proteins of colorectal cancer cells
   GSTEN00005209G001
CD molecules [BR:tng04090]
 Proteins
  GSTEN00005209G001
SSDB
Motif
Pfam: Tetraspanin
Other DBs
NCBI-ProteinID: CAF90793
UniProt: Q4T8I9
LinkDB
Position
undetermined
AA seq 260 aa
MGNGCVTATKYFLFLLNFIFFLCGAVIVGFGLWLLLDNQSFIVVLSDSTAVKTACYILIG
VGAFSMLLGFLGCLGAIYEVRCLLGLVSPAARATVVTVGTGVTLVSSPLLFQYFACLLLI
LLAQITAGTLIYFQKDALHEETFKVIGTVLDGYPGNNSSVMQAWDFIQRTMECCGWTSQQ
DWSGNMIIKNSSMLLFPCSCQNISTAAGNASDSGFCEAPTPDWPVYEAVSELLGFFVVXX
XXXXXXXXXXXXXXXVHLFL
NT seq 783 nt   +upstreamnt  +downstreamnt
atgggcaacggctgcgtgacggcaaccaagtacttcctgttcctgctcaacttcatcttc
ttcctctgtggtgccgtcatcgtgggattcggactctggctcctcctggacaatcagagc
ttcatcgtggttctcagcgactccacggccgtgaagacggcctgctacatcctgatcggc
gtgggcgccttctccatgctcctgggcttcctcggctgcttgggggccatttacgaggtc
cgctgcctgctgggcctggtgagtccggctgcgagggccacggtcgtgactgtgggcacc
ggtgtgacgctcgtgtcctcgcctctcctcttccagtacttcgcctgcctgctgctcatc
ctcctggctcagatcaccgccggcaccctcatctacttccagaaggacgcgttacacgag
gaaaccttcaaggtcatcggcacagtgctggatggttaccctggcaacaactcctcggtg
atgcaggcctgggacttcatccagaggaccatggagtgttgcggctggaccagccagcag
gactggagcgggaacatgatcatcaagaacagctccatgctgctcttcccctgctcctgc
cagaacatctccacggccgccggaaacgcctccgacagcggcttctgtgaggccccgacg
cccgactggcccgtctatgaggcggtgagtgagcttttggggttttttgtcgtnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntagtccatttatttttg
taa

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00029791G001
Entry
GSTEN00029791G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K06509  CD82 antigen
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00029791G001
Exosome [BR:tng04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GSTEN00029791G001
  Exosomal proteins of other body fluids (saliva and urine)
   GSTEN00029791G001
  Exosomal proteins of colorectal cancer cells
   GSTEN00029791G001
CD molecules [BR:tng04090]
 Proteins
  GSTEN00029791G001
SSDB
Motif
Pfam: Tetraspanin DUF4229
Other DBs
NCBI-ProteinID: CAG08727
UniProt: Q4RSA5
LinkDB
Position
13
AA seq 256 aa
MGKGCITVTKYFLFLFNLLFFVFGGLIMGFGLWVLLENQSFIAVLQESSDTVKVASYILI
GVGSLSMALGFFGCIGAIYEVRCLLGLYFTFLLLILIAQVTAGVLIYFQRDRLKHEMSDI
IKDMIVTYTGVNRTAEHTWDYIQKTMKCCGWTGPGNWSNNLLIKNSSQNLYPCSCRNESL
PGSDIRPVGLCEHLSTDLPVYETGCITNVEKWLLENCGVILGICAVVAVIELLGMILSMF
LCKSVVQEDYSKVPKY
NT seq 771 nt   +upstreamnt  +downstreamnt
atggggaaaggctgcataacagtaaccaaatactttctgttcctcttcaaccttctcttt
tttgtttttggggggttgatcatgggcttcggtctgtgggtccttcttgagaaccagagc
ttcattgctgtcctgcaggaatcgtcagatacagtgaaagtggcttcctacatcctcatt
ggagtgggctccttgtccatggccctgggcttctttggctgcatcggagccatctatgaa
gtccgctgtttgctgggtttgtatttcacgttcctactgcttatcctgattgcccaggtc
accgctggagtcctcatttacttccaaagagatcggctgaaacatgagatgtccgacatc
ataaaggacatgatcgtcacctacactggcgtgaacaggactgctgagcacacctgggac
tacatccagaaaacaatgaagtgctgtgggtggactgggcctggaaactggtctaacaac
ctcctgatcaagaacagctctcagaacctgtacccgtgttcctgtcgcaacgagtctctg
cctggctccgacatcaggcccgtgggcctgtgtgaacacctgtcgacagatctacctgtg
tacgaaacgggctgtataaccaatgtagagaaatggctgctagaaaactgcggagtgatc
ctgggaatctgcgccgtagtggccgtcatagagctcctcgggatgatcctctccatgttt
ttgtgcaagagcgtggtgcaggaggattacagcaaggtgccgaagtactga

DBGET integrated database retrieval system