KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00005388G001
Entry
GSTEN00005388G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng03440  Homologous recombination
tng04068  FoxO signaling pathway
tng04110  Cell cycle
tng04115  p53 signaling pathway
tng04210  Apoptosis
tng04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:tng00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    GSTEN00005388G001
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    GSTEN00005388G001
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00005388G001
   04210 Apoptosis
    GSTEN00005388G001
   04115 p53 signaling pathway
    GSTEN00005388G001
   04218 Cellular senescence
    GSTEN00005388G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tng01001]
    GSTEN00005388G001
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tng03032]
    GSTEN00005388G001
   03400 DNA repair and recombination proteins [BR:tng03400]
    GSTEN00005388G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     GSTEN00005388G001
Protein kinases [BR:tng01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   GSTEN00005388G001
DNA replication proteins [BR:tng03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     GSTEN00005388G001
DNA repair and recombination proteins [BR:tng03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    GSTEN00005388G001
SSDB
Motif
Pfam: PI3_PI4_kinase FAT FATC
Other DBs
NCBI-ProteinID: CAF90921
UniProt: Q4T861
LinkDB
Position
undetermined
AA seq 2325 aa
GARSPLSEEHLTQGDLALLAVVDFLCECGSVQPVHRLHFKPQEVRRKLLLLLEQVDFSRA
LHLHMVCVRECVCVCVCVWPRYAYNPPVFQYLVLLRKLPAGDSLAPEEFTSLLRPLADLC
SDYRQDQDVCAAVLLALLPSVRSLGGCPHPPEDLTHVRGMLLHMVSGFWSVSQEFPLKPH
LPSCIRIVPGYRLFCVCPVCSYLSQTGKCVAPVRVALVRCLVALLEADPRCRWAVLSLKG
QDGREKDVSAVLSSHLADAHHQVRMLVATSVERYAADQRTRTSAGIQTPLTSTCMSRFFL
EVGPDRKMLPLKQQQEAFEHVYLRAQEGMLLPKNCSPDDQRDESSNRKAALLRSLCVVLC
CSPVCEKQALFALFQSYKENSIEEQLIKKILGSVCGVLGYSSVRTFVGSHLYYLVAEWLA
QRQSDDRYTLGSFPYSVLDQETVAGFYRSSYQVLVPHLVLLDDFEQVKSIGRCLGKDWKE
LLADCFPKIMVNILPYFALGGQEALVAQQREKAHRVYDLLTDSSYLGKQEIDSLIHSNLA
DIVVELLMTLYEGSGPEGDLRRFVGELDPAPNPPYFSSSVIKATLDYLSRCHSTSRRSLV
AVLSKTPISIQRILLAVCERGAGTTNGYERHRILLVYHLFVSLLLAEVEDGLGGAWAFVL
RDVVYTLVHHINSSPLRPVEVSDRSVALCCDLLTSVCRAALRFCDGALDCHLQVIVGTLM
AQVTSRPPPISQQMLGLLQFLIIENQQKLKEVISKLEPFPNLPEFAELRSVQKKLQPGTS
TLSQEVMRFLSVTSCDSVLLTRLEGLKQLSRQLRDNRAQIRELLRQCHAEHGDSLPVKLV
LSLLQLCKLAVHQPGGADILEAVGSCLGELGPVDLSTIALLHGRDPLYKRSADLFDSPEL
QQLYVALSCMNDALTQPSIEVRSAAALCVKNLLAAQSGVDFWEKYKDSQDPLLIYLNPLR
KAKKKVEALSAEQSPEARDKLEDRSLWVVQAGSHRPWLKTLCTALLDSGGVRSEALLLSR
PLCLVRTWTPPSGAVAGLTWASHPPPPPLPPPRCGQTAVSGCCPSWFHSVLQHDPDGSWR
CSLSSCFQEFFRFCCRRPQASSRSTTPLSCDSESDASSQGVHDKNSLRTMLAVLDYLRHQ
KRASSDGSDGTVCDSNFWLELNYLEVAKAAQSCSAHFTALLYAEIYVDKLKADLEDAHRS
TSRATRRLTFEDTSQTFSISSLNKKSVEDAQISLQELLFEVYRSIGEPDSLYGCGGETVT
SPLTRIRTYEHEALWGKALTSYDLHTSLPEVTRHVGIVEGLQNFGLSGILATYMRGLESE
GVELGWELRELRFQAAWRNSQWDCELPERDELQPGFHQSVFCSLQALRDREFSVFEQMVK
QARTALVEELCRGSLEAVSSLYPALRDLQSIRQLEDIHPLFSRPFSGVGLEDVCRQWRQQ
SQLLGDSDFALVEPILAARSVGLHSLMTRMGDPDSRQHVGSMLTEHLLDMCQLARKAGNT
QLAERAVFQMKQHASAGSWVLTPVSSWQLEEAQVFWAKGDQELALGLLRRIVSNLEETVD
LNPALVPVYTESLRLCGNWLAETCLESPGVILENYLERALEVIQRDGGSHQDARLLRQRT
EAFLSLARFSDMQYQIIGKYMSSSEFENKQALLQKAKEEVGLLREHNVVGRYTTKVQKEL
ELDEKALSNLQADRRRFLCKAVENYVQCLEEGEEHDTWVFRLASLWLENGHVAAVNATME
VRDVPSKARPPRPGGWLLTPSFAVFLPPQNGVKKIPSHKFLPLMYQLAARMGTKTVSEDR
GFHGVLFELISRACLEHPHHTLFIILALVNANKDKAFCEVPVSKGVPWEPSPLDLERSDK
AQMIVNVVRKKRSQLVRGMERLSDAYITLAYMDASRHKTEKREIPIPADQPIVKIRDLDE
VVIPTLELKVDPSGRYDNLVTIRSFMPRYKLVGGVNLPKIIHCVGSDGESRRQLVKGKDD
LRQDAVMQQVFGMCSMLLQRNSDTRKRKLNIRRYKVVPFSQKSGVLEWCSETVPISLFLV
DPKQGAHRRFRPQDWTSMECRVKMMNAVGFDEKLQAYAEVCRNFRPVFRFFCMERFQDPA
VWMEKRLAYTRSVATSSIVGYIVGLGDRHINNILIDEQSAELIHIDLGVAFEQGKILPTP
ETVPFRLSRDIVDGMGITGVEGVFRRCCEKTLEVMRSSLEALLTIVEVLLYDPLFDWTMN
PLKALYLQRDEQQELNATLGSTMGRDHLDSQRKLRPSDCGALGPAGTVRASTRWRSAVLL
RLQEKLKGVEEGAVLSVGGQVNLLIQQALDPRNLSRLFPGWQAWV
NT seq 6978 nt   +upstreamnt  +downstreamnt
ggggcccgaagtccactttcagaggagcacctgacccaaggggacctggctctgctggcc
gtggtggacttcctgtgtgagtgcggttccgtccagcccgtccaccgtctgcacttcaag
ccgcaggaggtgcggcgcaagctgctgctgctgctggagcaggtggacttcagcagggct
ctgcatctccacatggtgtgtgtgcgcgagtgtgtgtgtgtgtgtgtgtgtgtgtggcct
cggtacgcctacaaccctcctgtcttccagtacctggtcctgctgaggaagctgcctgct
ggagactctctggccccagaagagttcacctccctgctccgccctcttgccgacctgtgt
tcggactaccgccaggaccaagacgtctgcgccgctgtcctgctggccctgctgccctcc
gtcaggagtctgggcgggtgcccccacccgcccgaggacctgacccacgttcggggaatg
ctgctccatatggtgtctggattctggtcagtctcgcaggagtttcctttaaaacctcac
ctcccaagctgcatccgcatcgtgcctggttacaggctgttttgcgtctgtcccgtttgc
agctacctgagccagacggggaaatgcgtggcccccgtccgcgtggccctggtgcgatgt
ctggtggctctgctggaggccgacccgcgctgtcgctgggccgttttgagcctgaagggc
caggacggcagagaaaaggacgtgtcggccgtgctctcgtcccacctggcggatgcccac
catcaggttcgcatgctggtggccacgtcggtggagaggtacgctgcggaccagcgcacg
cggacgagcgctggaatccagactccgctgacgtccacctgcatgtccaggttcttcctg
gaggttgggcccgaccggaagatgctgcccctgaagcagcagcaggaggccttcgagcac
gtttacctgagggctcaggaggggatgctcctcccgaagaactgctccccggacgaccag
cgggacgagtcctccaaccgcaaggcggccctgttgaggagtctgtgcgtggtgctctgc
tgcagccccgtctgtgagaagcaggcgctcttcgccctcttccagtcctacaaggagaac
agcatagaggagcagctcatcaagaagatactgggcagtgtgtgtggagtgctgggctac
agcagtgtgaggaccttcgtgggctcccatctctactacctggtggcggagtggttggcg
cagaggcagtcggacgaccgctacaccctgggctcctttccctacagcgtcctggaccag
gagacggttgcaggcttctacaggtcctcctaccaggtcctggtccctcacctggtcctc
ctggatgactttgagcaggtgaagtccatcggcaggtgtctggggaaggactggaaggag
ctactggccgactgtttccctaaaatcatggtgaacatcctgccctacttcgccctgggc
ggccaggaggcgctggtggcgcagcagcgggagaaggcccacagggtgtacgacctgctg
acggacagcagctacctgggcaaacaggagatcgactccctgatccacagcaacctggca
gacatcgtggtggagctgctgatgacgctgtacgaagggagtggacccgaaggggacctg
cggcgctttgtgggggaattggaccccgcgcccaacccgccctatttcagctcctccgtg
atcaaagccaccctggactacctgagccgatgccacagcaccagccgcaggtccctggtg
gccgtcctgtccaaaactccgatctccatccagaggatcctgctggccgtgtgcgagagg
ggggcgggaaccaccaacggctacgagcgccaccgcatcctcctcgtgtaccacctgttt
gtgagcctgctgctggcggaggtggaggacggtctgggaggagcctgggccttcgtcctc
agggacgtcgtgtacacgctcgttcaccacatcaacagcagcccgcttcgccccgtcgag
gtttccgacagaagcgtcgctctctgctgcgacctcttgacatccgtgtgccgcgcggct
ctgcggttctgcgacggcgctctagactgccatctacaggtcatcgtggggactctgatg
gcccaggtgaccagccggccccctcccatctcgcagcagatgctcggactgctgcagttc
ctcatcatagagaatcagcagaaactgaaagaggtcatcagcaagttggagccgtttccg
aacctccctgagttcgcggagctgcgatctgtgcagaagaagctccagccggggacctcc
acactgagccaggaggtgatgcgcttcctgtcggtcacctcctgcgactccgtgctcctg
accagactggagggcctgaagcagctgagccgacagctccgtgacaacagggcgcagatc
agggagctcctccgccaatgccacgcggagcatggcgacagcctgccggtaaagctggtg
ctcagcctgctgcagctgtgtaaactggcggtccaccagcccggaggagccgacatcctc
gaggccgtgggcagctgtctgggagaactgggacctgtggacctgtccaccatcgccctg
ctgcacggcagagaccccctctataagaggtcggccgatctcttcgactcccccgagctg
cagcagctctacgtcgccctcagctgcatgaacgacgcgctcactcagcccagcatcgaa
gtgagatcggctgctgctctgtgcgtgaagaacctcctggctgctcagtctggtgtggat
ttctgggagaagtacaaagacagccaggaccccctgctgatctacctgaatcccctcagg
aaggccaagaaaaaggtggaagcgctcagtgctgagcagagcccggaggcccgggacaag
ctggaggaccggtcgttgtgggtggtccaggcaggcagccacaggccctggctgaagacg
ctgtgcaccgccctgctggacagcggaggggtcaggagcgaagcgctgctgctgtcccgg
cccttgtgtctggtgagaacctggacgcccccctcgggtgcggtggcaggtctcacctgg
gcctctcaccctcctcctcctcctcttcctccccccaggtgtgggcagactgctgtcagc
ggctgctgcccctcatggttccactccgtcctccagcacgaccctgacggttcctggagg
tgctcgctctcctcctgcttccaggagttcttccgcttctgctgcaggaggcctcaggcc
tccagccgctccaccacgccgctcagctgcgactcggagtcggatgcttccagtcagggt
gtgcacgacaagaactccctgcgcaccatgttggctgttctggactacctgagacaccag
aaacgagcgtcctctgacggctctgacgggaccgtgtgtgactcaaacttctggctggag
ctgaactacctggaggtggccaaagctgctcagtcctgctcggcgcatttcaccgccctg
ctgtacgcggagatctacgtggacaagctcaaggctgacctggaggacgcccacaggtcc
acgtccagggcaacgcgcagactcacctttgaagacaccagccagaccttcagcatctcc
agcctcaacaagaagagcgtggaagacgcccaaatcagcctgcaggagctgctgttcgag
gtctaccggagcatcggagaacccgacagcctgtacggctgcggcggcgagaccgtgacc
agccccctgaccaggatccggacctatgaacacgaggccctgtgggggaaggccctgacc
tcctacgacctccacacctctctgcccgaagtcacccgacacgttgggatcgtagagggc
ctgcagaacttcggcctgagcggcatcctggccacctacatgaggggcctggagagcgaa
ggggtggagctgggatgggagctgagggagctccgcttccaggctgcctggaggaactcc
cagtgggactgcgagctgccagagagggacgagctccagcccggcttccaccaatcggtc
ttctgttccctgcaagcgctgagggaccgggagttcagcgtgtttgagcagatggtgaag
caggctcggactgcgctggtggaggagctgtgcaggggaagtctggaggctgtgtcctcc
ttgtacccggctctcagggacctccagagcatccggcagctggaggacatccatccgctc
ttctccaggcccttctcgggcgtgggtctggaagacgtctgccgccagtggcgccagcag
tcgcagctgctcggtgacagcgactttgccctggtggagcccatcctggcggcgcgctcg
gtgggcctgcactccctgatgaccaggatgggagaccccgacagcaggcagcacgtcggc
tccatgctgaccgagcatctcctggacatgtgtcagctggctcgcaaggctgggaacaca
cagctggcggagcgtgcagtcttccagatgaaacagcacgcttcggcagggtcgtgggtg
ttgaccccggtgtcgtcatggcaactagaggaagcccaagtgttctgggcaaagggcgac
caggagctggctctgggtctgctgaggcggatcgtaagcaatttggaggaaacggtggac
ctaaaccccgccctggtgccagtctacaccgagagcctccggctgtgtggtaactggctg
gcagagacgtgcctggaaagtcctggagtgatcctggaaaactacctggagagggcgctg
gaggtgatccagagggacgggggctctcatcaggatgcccggctgctgcgccaacggaca
gaggccttcctgtccctggcgcgcttctccgacatgcagtaccagattatcggcaagtac
atgagctcctcggagtttgagaacaagcaggcgctgctgcagaaggccaaggaggaagtg
ggcttgttgcgggagcacaacgtggtcggcaggtacaccacgaaggtgcagaaggagctg
gagctggacgagaaggccttgtccaacctgcaggcggacaggcggcgcttcctctgcaag
gcggtggagaactacgtccagtgcctggaggagggagaggagcacgacacctgggtgttc
cgcctggcctcgctctggctggagaacggccacgtggccgccgtaaacgccaccatggag
gtcagggacgtccccagcaaagcgcgtcccccccgacccggcggatggctgctcaccccg
tctttcgccgtttttcttcctccccagaacggggtgaagaagatcccctcccacaagttt
ctgcctctgatgtaccagctggccgctcgtatgggcacgaagacggtgtccgaggacagg
ggcttccacggcgtcctcttcgagctgatcagtagagcgtgtttggagcaccctcaccac
acgctcttcatcatcctagccctggtcaacgccaacaaggacaaggccttctgcgaggtg
cccgtgtccaagggcgtcccctgggagccctcgcccctcgacctggagcgctccgacaaa
gcccagatgatcgtcaacgtggtcaggaagaagagaagccagctggtgcgagggatggag
cgcctgagcgatgcctacatcaccctggcctacatggacgccagcaggcacaaaaccgag
aagagggagattcccatccctgccgatcagcccatcgtgaagatccgggatctggacgag
gtggtcatccccaccctggagctgaaggtggatccatccggtcgctacgacaacctggtg
acgatcaggtccttcatgcctcgatataaactggtgggcggagtcaacctgccgaagatc
atccactgcgtgggctcggatggggaaagtaggaggcagctggtgaagggcaaggacgac
ctgcggcaggatgcggtgatgcagcaggtcttcggcatgtgctccatgctgctgcagcgc
aacagcgacacccgcaagaggaagctcaacatcaggcgctacaaggtggtgcccttctcc
cagaagagcggtgttctggagtggtgctccgagacggtgccgatcagcctcttcctggtg
gacccgaagcagggagcccaccggcgtttccgaccgcaggactggaccagcatggagtgc
cgcgtgaagatgatgaatgccgttggctttgacgagaagctccaggcctacgccgaggtg
tgccgcaacttccggcccgtcttccggtttttctgcatggagcgctttcaggacccggcg
gtgtggatggagaagcggctggcctacacccgcagcgtggccacctcctccatagtgggc
tacatcgtgggcctgggggaccgccacatcaacaacatcctgatcgacgagcagagcgcc
gagctgatccacatcgacctgggcgtggcctttgagcaggggaagattctccccaccccc
gagaccgtccccttcaggctgtccagggacatcgtggacggcatgggcatcaccggcgtg
gagggcgtcttccggaggtgctgtgagaagaccctggaggtgatgcggagctccctggaa
gctctgctgaccattgtggaggtgctgctctacgaccccctgtttgactggaccatgaac
cccctgaaggccttgtacctgcagcgggacgagcagcaggagctcaacgccaccctgggc
tccaccatgggcagagaccacctggacagccagcgcaaactcaggccttctgattgtggt
gctctgggtccggcagggacagtcagagcttcaacaaggtggcggagcgcggtcctgctg
cggctgcaggagaagctgaagggggtggaggagggcgcggtgctcagcgtcggggggcag
gtcaacctcctgatccagcaggccctggaccccaggaacctgagcaggctgttcccaggc
tggcaggcctgggtgtag

DBGET integrated database retrieval system