KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00006442G001
Entry
GSTEN00006442G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
tng04120  Ubiquitin mediated proteolysis
tng04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    GSTEN00006442G001
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    GSTEN00006442G001
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00006442G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:tng04121]
    GSTEN00006442G001
Enzymes [BR:tng01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     GSTEN00006442G001
Ubiquitin system [BR:tng04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    GSTEN00006442G001
SSDB
Motif
Pfam: Sina zf-C3HC4_3
Other DBs
NCBI-ProteinID: CAF91602
UniProt: Q4T680
LinkDB
Position
undetermined
AA seq 283 aa
MSRQTATALPTGTSKCPPSQRVPTLSGTTASNSDLASLFECPVCFDYVLPPILQCQSGHL
VVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEVTLPHTEKTEHEE
LCDVPALLLPLPGGLLQVAGLAGRRHAPPDAPAQVHHHAAGRGHRLPGHGHQPAGRGGLG
DDAVLLRLPLHAGAGEAGEVRRPPAVLRHRAAHRHPQAGRELCLPAGAERPPAPADLGGH
AALHPRRHRHRHHEQRLPVFDTSIAQLFAENGNLGINVTISMC
NT seq 849 nt   +upstreamnt  +downstreamnt
atgagtcgccagaccgccaccgcgctgcccacaggaacctccaagtgtcctccctcccag
cgcgtgcccaccctgtcgggcaccacggcctccaacagcgacctggccagcctcttcgag
tgccccgtctgcttcgactatgtgctcccccccatcctgcagtgccagtcggggcacctg
gtagtgtgctccaactgccggcccaagctgacctgctgccccacctgccggggccccctg
ggctccatcaggaacctggccatggagaaggtggccaactcggtgctgttcccctgcaag
tacgcctcctcgggctgcgaggtgacgctgccgcacacggagaagacggagcacgaggag
ctgtgcgatgttccggccctactcctgcccctgcccgggggcctcctgcaagtggcaggg
ctcgctggacgccgtcatgccccacctgatgcaccagcacaagtccatcaccacgctgca
gggcgaggacatcgtcttcctggccacggacatcaacctgccgggcgcggtggactgggt
gatgatgcagtcctgcttcggcttccacttcatgctggtgctggagaagcaggagaagta
cgacggccaccagcagttcttcgccatcgtgcagctcatcggcacccgcaagcaggccga
gaactttgcctaccggctggagctgaacggccaccggcgccggctgacctgggaggccac
gccgcgctccatccacgaaggcatcgccaccgccatcatgaacagcgactgcctgtcttc
gacacctccatcgcgcagctcttcgccgagaacggcaacctgggcatcaacgtcaccatc
tccatgtgc

DBGET integrated database retrieval system