KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00006991G001
Entry
GSTEN00006991G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K05437  erythropoietin
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    GSTEN00006991G001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tng04052]
    GSTEN00006991G001
Cytokines and growth factors [BR:tng04052]
 Cytokines
  CSF and other factors
   GSTEN00006991G001
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-ProteinID: CAF91978
UniProt: Q4T554
LinkDB
Position
undetermined
AA seq 180 aa
MTGLLAFLLIVLEWTRPSLPSPLRPICDLRVLNHFIKEAQDAEAAMKTCREGCTLSESVV
VPQTTVDFDVWEKKNASAKAEEVQSGLWLLQQAFNFLRTSVTNAALHSHIDNAVRNLLSV
NAVLRSLNIQEFTPQANGAEIEGTWRASSAAELLQVYVNFLRGKARLLLLDAQACQQDVS
NT seq 543 nt   +upstreamnt  +downstreamnt
atgacaggattgcttgccttcctgttgatcgtgttggagtggacccggccaagcctgcca
tcgcccctgagacccatctgtgacctgagagtcctcaaccatttcatcaaggaggcccaa
gacgccgaagccgccatgaagacctgtagagagggatgcaccctgtcagagtctgtggtc
gttccccagacaacagtggattttgacgtctgggagaagaaaaacgcatcagcgaaggcc
gaggaagtgcagtctggcttgtggctcctacagcaggccttcaacttcctacggacttct
gtcaccaacgcagccctgcacagccacatagacaacgccgtccgaaacctgctcagcgtc
aacgctgtgctgcgcagcctcaacatccaggaatttaccccacaagccaacggggccgag
atagagggaacgtggcgggcgtcctcggcagcggagctgctccaggtctacgtcaacttc
ctgcgaggcaaagcgcgcctcctcctcctggacgcgcaggcctgtcagcaagatgtcagc
tga

DBGET integrated database retrieval system