KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00007299G001
Entry
GSTEN00007299G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04291  lysophosphatidic acid receptor 2
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04080  Neuroactive ligand-receptor interaction
tng04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    GSTEN00007299G001
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    GSTEN00007299G001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:tng04030]
    GSTEN00007299G001
G protein-coupled receptors [BR:tng04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    GSTEN00007299G001
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-ProteinID: CAF92197
UniProt: Q4T4I5
LinkDB
Position
undetermined
AA seq 347 aa
MESVLMDQNLDSSWSTCDYTRNVTFFYNLVGKEIRTVWTTRDIVVIGLGLTVCVIVSLAN
IMVMVAIFVNHRFHFPIYYLLGNMAAADLFAGMAYANLMLNTGPWTSTLTKQQWYVRGAL
IDISLTASVGSLLAVAVERHQTVITMQLHSTMTRRRVVLLIAGHLGRERRHGLGALHRLE
LRVRPEGLFHRGTHLQQALPGVLGRTQFVDVPGHGGHVRPHLCHCELQEQVHVPAHGRPE
QQPDCDQPDENHLHGFRSVRGLLDSGPGDSPTGRAAGPRQPRQHVREVLPGDGGVQLSGQ
PRHLRSARPGDAPHVQVDPVLPVRKEAAEGSLAAGVHPSTDSASGTR
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggaatctgttctgatggaccagaatttagacagttcatggagcacctgcgactacacc
cgcaatgtcaccttcttctacaatttggtgggtaaagagatccggacagtgtggacgacg
cgggacattgtggtgattggtctgggactgaccgtgtgcgtcatcgtatccctggccaac
atcatggtgatggtggccatcttcgtgaaccaccgcttccacttccccatctactatctc
ctgggcaacatggctgcggccgacctgtttgcagggatggcgtacgccaacctgatgctg
aacacgggcccctggaccagcacgctcaccaagcagcagtggtacgtccgcggagcgctg
atcgacatcagcctgacggcctcggtgggcagcctgctggccgtggccgtggagcgccac
cagaccgtcatcaccatgcagctgcacagcaccatgaccaggcggcgcgtggtgctgctg
atcgctgggcatctgggccgtgagcgtcgccatgggcttggtgccctccaccgtctggaa
ctgcgagtgcgacctgagggactgttccaccgtggcacccatttacagcaagcgcttcct
ggtgttctgggcaggactcaatttgttgacgttcctggtcatggtggccatgtacgcccg
catctttgtcattgtgagctacaggagcaggtacacgtcccagcacacggccgacctgag
caacagccagactgtgatcaacctgatgaaaaccatctccatggttttaggagcgttcgt
ggtctgctggactccgggcctggtgattctcctactggacgggctgctgggccgagacag
ccacgccaacacgtacgagaagttctgcctggtgatggcggagtgcaactctctggtcaa
ccccgtcatctacgctctgcgcgaccgggagatgcgccgcacgttcaggtggatcctgtg
ctgcctgtgcggaaggaagcagccgagggaagcctggccgctggagttcaccccagcacc
gacagcgcctcaggaacccgctga

DBGET integrated database retrieval system