KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00007367G001Help
Entry
GSTEN00007367G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    GSTEN00007367G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tng03036]
    GSTEN00007367G001
Enzymes [BR:tng01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     GSTEN00007367G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     GSTEN00007367G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1 HALZ DUF3452 MTS Prominin
Motif
Other DBs
NCBI-ProteinID: CAF92242
UniProt: Q4T4E0
LinkDB All DBs
Position
undetermined
AA seq 1222 aa AA seqDB search
MRSLAHGRARAEVCVAVAGRFEGELGSSVRLCLAGRWRRREKVGQWDKHHDAAHEIIETI
RWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNKR
PSNGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQIIDEMEMREDDTFVD
LGSGVGQVVLQVAAATNCKHYYGVEKADIPATYAETMDKEFKKWMKWYGKKHGEYTLERG
DFLSEEWKERIANTSIIFVNNFAFGPEVDHQLKERFANMKEGGKIVSSKPFAPLNFRINS
RNLSDIGTIMRVVELSPLRGSVSWTGKPVSYYLHTIDRTILENYFASLKNPKLREEQEAA
RRRQQKDSKDCKSNSTTPTKPKDLPKQDSCGEEERPRLVTVVKPSAKPRRAKLLSKGRKL
NNRKRGRPKKAALVTEKKNKKNQSALDLLHAKTLSAAPSQDAYRSAQSPFYQLPPKVQHY
PSSQLLLSSTPPALQQLLDNFKVQYLQFMAHMKTPQYRSNLQQLLEQEKQKHRDLSGQVE
QLHSVCQSHKDKIKGLFQTKLDELGVKALTVEDLLQAQKEISAHNRQLKEQTKQLERDMS
LLRDHSLLLLKSRCEELKLDWGSLCLESLLKEKQALRRQISEKQRHCLELQISIVELEKS
QRQQELLQLKSYSPCDGSPYRKSLESRSSTDMDSKLSLSSAPAVNGGGPELSVNGTSSPC
FDRTSTKGEVLSRYLPISPDHEITAPASDTRQRQQNSSYALPDYTRFSPAKIALRRHLNQ
DPNASSNFRGPDYCKYLAFPHFGFREVGGINSPLGAKQNCASPSAADTHNVPKSFEKGGK
DRSPSIQGDNITSLPISIPLSTVHPSKLPVSIPLASVVLPSRAEKLRNTPSPVSQAGHTN
GLTNGSCHAEDHNGASSPPSHTSNLLSGSVGRGGPVQSPPRSTGGVLQYADGPPRILPEE
GQDHQGEEYPPLLTFFSSSCCVSSAGTGGSTTGGSRSHHHSLAKQGYHSNHGNHHHHSPS
TQHGHPPSHVSSSVSAHSLSIQEGRKRGRRKRSSTAVVNACSSPKRRSFPGIGTNGHSSG
SPLNINSMVSNINQPLEISAISSPEQSSPNGPDLDQPPILKRERPLELNGTGCCSSGPSS
DGEDSGYPADNSSARIERKIATISLESRDGPGRLGESERENPAAAVVTAQEVTPPLPHLC
LPPASGKLHFRLYLTPNNPALT
NT seq 3669 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagcttggcgcatgggcgagcgcgggcggaagtttgcgtagcagtggcgggcaga
ttcgagggggaattaggaagctcagtgcgcctctgcttggcagggcgctggagaaggaga
gagaaagtgggtcagtgggataaacaccacgatgctgctcatgaaatcatcgagaccatt
cggtgggtgtgtgaagagatcccagaccttaaactggccatggaaaactatgtacttatc
gactatgataccaagagctttgagagtatgcagaggctctgcgacaagtacaacagggcc
atcgacagcattcaccagctgtggaaggggaccacccagcctatgaagctgaacaagcgt
ccttccaacgggcttctgagacacatcctgcagcaggtctataaccattcagtgacggac
ccggagaagctgaacaactatgagcccttctcacctgaggtgtacggagagacctctttc
gacctggtggctcaaattattgatgagatggaaatgagggaggacgacacctttgtggac
ctgggcagtggagtgggacaggtggtgctgcaggttgctgcagccaccaactgtaaacac
tactacggtgtggagaaagcagacattccagctacctatgcagagaccatggataaagag
tttaaaaagtggatgaaatggtatgggaagaaacacggggagtacacactggagagagga
gactttctgtctgaagaatggaaggaaaggatagcaaacacgagtattatttttgtgaat
aactttgccttcggaccagaagtagatcatcagcttaaagagcgctttgctaacatgaag
gaaggtgggaaaattgtgtcctccaaaccttttgcacctctgaattttagaataaacagt
cgaaacttgagcgatattggcacaataatgcgtgtggtggagctttctcctctcaggggc
tcagtgtcgtggacaggaaagccagtttcctactacctgcataccatagaccgcaccata
cttgaaaattatttcgcaagtctcaaaaatcctaaactcagggaagagcaagaggcagct
agacggcgtcagcagaaggacagcaaagactgcaagagcaatagcaccacacccaccaaa
cctaaagatctgccgaagcaggactcctgtggggaggaggaacgtcccagactggtgaca
gtggtcaagccttctgccaaaccaaggagggccaagctgctgtctaaaggtcgcaagttg
aacaacaggaagcgtggtcgtccgaagaaagccgctctggtgacagagaaaaagaacaag
aagaaccagagcgctttagatctgctgcacgctaagaccctctctgcagcgccctctcag
gatgcgtaccggtcagctcagagccccttctaccagctacctcccaaggtccagcattat
ccttcaagtcagctgctcttgagctcaactccacctgctctccaacagctgcttgataac
ttcaaagttcagtaccttcagtttatggcacacatgaagactcctcagtatcgctccaac
ctgcagcagctcctggaacaggagaagcaaaaacacagggacctgtcagggcaggtggag
cagcttcactccgtctgccagtctcacaaggacaagattaaaggtctctttcagaccaaa
ctggatgagctgggagtgaaagccttgactgtggaggacctgctgcaggctcagaaggag
atatcggctcacaatcgtcagctcaaggagcagacgaagcagctggagagagacatgtcc
ttattgagagatcacagtctactactgctcaagtctcgatgtgaagagctgaagctggac
tggggctcgttgtgtttggagagtttgttgaaggagaaacaggcactacgcagacaaata
tctgaaaaacagagacactgcttggagctgcagatcagcattgtggagttggagaagagt
caaaggcagcaggagctgcttcagctgaagtcctacagtccctgtgacggctctccatac
agaaagagcctggagtcacgatcttccacagacatggactcaaaactcagcctgtcctct
gccccagccgtgaatggtggcggaccagagctttcagtgaacggcaccagttccccgtgt
tttgaccggacaagcacaaagggggaggttctctcgcgatacctacccatctctccagac
cacgagatcacagccccggcctctgatacccgacagcggcaacagaattcctcatacgcg
cttccagattacactcgcttctcccctgccaagattgccttgcggaggcatctcaaccaa
gaccccaatgcctcttcgaacttcagaggcccagactattgcaaatatttagcttttccc
cattttggttttagggaagtaggcggcatcaactccccacttggagccaagcagaactgc
gcttctcccagtgcagccgatactcataatgttcctaaaagttttgaaaagggggggaag
gacaggagcccttccattcagggtgacaacatcacaagccttcccattagtatccctctg
agtactgtccaccccagtaagctaccagtcagtattcccctggccagtgtggtgctgccc
agtcgtgccgagaaactgagaaatacaccgagtccagtgtctcaggcaggtcataccaat
ggactgactaatggaagttgccatgctgaggaccacaatggtgcttcttcacctccttca
cacaccagtaatcttttatcaggatcagtgggccgaggtggtcctgtccagagcccccca
cgcagcactggaggggtgctccagtatgcagacggcccccccaggattctaccggaagag
gggcaggaccaccagggagaggagtatcctcctcttctgacttttttttcatcttcgtgt
tgtgtttcgtcagcaggtactggaggcagcacaaccggaggatcgcgctcccaccaccat
agcctagccaagcaggggtatcacagtaaccacggaaaccaccaccatcactcccccagc
acacagcatggtcacccaccttcgcatgtgtcgtcatcagtctccgctcacagcctcagc
attcaggaggggcggaagagggggaggaggaagaggagctccacagcagttgtcaatgcc
tgcagctctccgaagagaaggtcctttcctgggattgggactaacggccattcctcaggc
tccccactcaatattaactcaatggtgagcaacatcaaccagcctctggagatctctgcc
atttcttcaccagaacagtctagccctaacggtcctgacctggaccagccccccatcttg
aagagggagcgccccctggagctgaatggcacaggctgttgctcctcaggccctagttct
gatggagaggactcgggataccctgctgataactccagtgcacgaattgaaaggaaaatt
gccacgatatctttggagagcagagatggacctggcagacttggtgaaagtgaaagagaa
aatccggcagcagcagtggtaacagcacaggaagtgacgcctcctcttcctcatctttgt
cttccaccggcaagtggaaagctacattttcgcctatatctgaccccaaacaacccagct
ctgacctga

DBGET integrated database retrieval system