KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00007555G001
Entry
GSTEN00007555G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K06641  serine/threonine-protein kinase CHEK2 [EC:2.7.11.1]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04110  Cell cycle
tng04115  p53 signaling pathway
tng04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00007555G001
   04115 p53 signaling pathway
    GSTEN00007555G001
   04218 Cellular senescence
    GSTEN00007555G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     GSTEN00007555G001
Protein kinases [BR:tng01001]
 Serine/threonine kinases: CAMK group
  RAD53 family
   GSTEN00007555G001
DNA repair and recombination proteins [BR:tng03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    GSTEN00007555G001
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr FHA Kdo Kinase-like FTA2 Yop-YscD_cpl Pkinase_fungal APH YrbL-PhoP_reg Haspin_kinase
Other DBs
NCBI-ProteinID: CAF92381
UniProt: Q4T401
LinkDB
Position
2
AA seq 517 aa
SQSKPQSQPASSSSSGPTTSSQSSSGSGTLSSVDTIPVTLPSVPEEPEAEPWGRLLPMAR
GFRSHGGSAASAAFNRASHAVPALLVCADCVEDQYLFGRDSKCNYVLDDPDNRGSRKFQI
YSKKHFRIYREGCEVFVEDYSNNGTFVDGILIGKNRKLPLVNNAVLALSERRNKVFVYID
LMSHDQSSLPKELQEKYLLTRQIGTGVCGEVKLAFERSSCRKYAVKIIKKKNFQSEGTAT
RNAQTEIEILQRIDHVSRSPGWGGGGGQEGRFPVSLSTLASLSPLLQPCLIKTLDFYQTD
DSYYIVLELMEGGELFHRVKSRQQLSESVTKLYFYQMLRAVQYLHSNGIIHRDLKPENIL
LSSQEERLSHQSVASVTDFNQSRILEETMLMRTLCGTPSYLAPEVFTQASTSGYGLAVDA
WSLGVLLFVCLGGYPPFHEGFGNVSISEQIIGGEFTMVPSKWRHVSDQGTAADVQPEVDA
ISPQLCVAAKDVVRKLLVVDPSRRMSIDQALEHPWLQ
NT seq 1551 nt   +upstreamnt  +downstreamnt
tcccagtccaaacctcagtctcagcctgcctccagttcttctagtggaccaaccacaagc
agccagtcctccagcgggtcggggacgctgagcagcgtggacaccatcccggtcaccctc
ccgtctgtcccggaggagccggaggcggaaccctgggggcgcctgctgcccatggcccga
ggcttcaggagccacggtgggtctgctgcttccgctgctttcaaccgggcctcacacgcc
gtcccggctttgcttgtgtgtgcagactgtgtggaggatcagtacctgtttggacgggac
tccaagtgtaactacgtcctggacgatccggacaacagaggctcccggaagttccagatc
tacagcaagaaacacttcaggatctacagagagggctgcgaggtgtttgtggaggactac
agtaataacggcacctttgttgatgggatcctgattgggaagaacaggaagctccctctg
gtcaacaacgccgtgctcgctctgtccgagcggcggaacaaagtctttgtctacattgac
ctgatgtcacatgatcagtccagtttacccaaagagctgcaggagaagtacctgctgact
cggcagatcggcacaggggtttgtggtgaggtgaagttggcttttgagagatcatcctgc
agaaaatatgcagtgaaaataatcaagaagaagaacttccagtctgaagggacagcaaca
cgaaacgcacaaacggagatcgagattctgcagagaatcgaccacgtgagtcggagcccc
gggtgggggggtggggggggacaggaaggacgcttcccagtgtccttgtccacgcttgcc
tccttgtctcctctcctgcagccttgcctcattaaaaccctggacttctaccagacagac
gacagctattacatcgtgttggagctgatggaggggggggagctcttccacagagtcaag
tctcggcagcagctttccgagtccgtcaccaaactttacttctatcagatgctgagagct
gtccagtacctccacagtaatgggatcatccacagagacctgaaaccagagaacatcctg
ctgtcctcccaggaggagcgtctgtctcatcaaagtgtagcgtcggtgacagacttcaac
cagtcccggatcctggaggagaccatgctgatgaggactctgtgcgggaccccgtcctac
ctggctcctgaggtcttcacgcaggcgtccaccagtggctacgggctggcggtggacgcc
tggagcctgggcgtgctgctcttcgtctgtctcgggggttaccctccgttccacgaaggt
tttgggaacgtgtccatcagcgagcagatcatcggcggcgagttcaccatggtcccgtcc
aagtggagacacgtctccgatcagggtaccgctgcagacgtccagccggaggtggacgcc
atctcaccccagctttgtgttgcagctaaagacgtcgtgaggaagctgctggtggtggac
cccagtcgcaggatgagcattgaccaggccctggagcacccctggttgcag

DBGET integrated database retrieval system