KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00007886G001Help
Entry
GSTEN00007886G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K12473  low-density lipoprotein receptor
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    GSTEN00007886G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tng04131]
    GSTEN00007886G001
Membrane trafficking [BR:tng04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    GSTEN00007886G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition EGF_CA cEGF SGL DUF5050 hEGF EGF Endomucin TMEM154
Motif
Other DBs
NCBI-ProteinID: CAF92585
UniProt: Q4T3E7
LinkDB All DBs
Position
18
AA seq 825 aa AA seqDB search
MYFPPEADAAFTCSSSQFMCGNGRCITRRWICDETDDCGDGTDELLETCASKTCMQSDYS
CGAPLYQCIPGRWHCDGKADCDNEADEKNCTAKQCKEDEFQCANGQCISASFVCDEDNDC
SDGSDEASCPKPTCSSRSFQCNNSVCVPARWRCDGDRDCADGSDEWPENCEGRQNKPAPR
CRSHEFQCADGECIHSSWRCDGGVDCKDRSDEANCSRPACSQDQFRCLDGACIAGALQCD
GMRDCTDHSDELDCHKVKACEGPTMFKCRTGECISMEKVCNKQADCRDSSDEPARECDID
ECQVDNGGCSHNCSDLKVGFNCSCPTGYSLKMDKKTCEDIDECAEPDTCSQICINLAGSY
KCDCLEGYQIDPLTKTCKAQAGVVPMLYFTNKHEVRRMTLDRSEYVRLIPQLKNVVALDI
DMPNGRIFWSDLFLKKIFSSRIDVAGNSSHHIAVIESGIEAPEGIAVDWIHGNIYWTDSA
LKTVSVAATDGSRRKTLITENLEKPRAIVVDPVNNFMYWTDWGEQAKIEKCGLNGVDRFA
LVTDNIVWPNGITLDVTNNRLYWVDSKLHTLSSIDVNGGTRHSILFSEEHLSHPISLTVF
ENQVFWTDMDHSAVMSANRLTGNDIKILATDLDQPEDIILYHDLKQPTGTNWCRESNSMN
GGCEFLCLPAPLINQRSAKFTCACPDNMVLGPDRRKCVTGPVVPPAEGRSEAPLQPKAAT
TTSPSPVTTATTTARRQTDPTSQAAVTAQGNKLPKEAPSSHPVALYVVLPIMVMTLLVFG
AVLVWRHWRLKNTNTIHFDNPVYQKTTEDELHICRNGSDGYIYPE
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgtatttcccacccgaagcagatgccgccttcacgtgcagttcctcccagtttatgtgc
ggaaatgggaggtgcatcacccgaaggtggatttgtgatgaaactgacgactgtggggac
ggaactgacgaactgctggaaacctgcgcatctaaaacctgtatgcagtccgactacagc
tgtggcgctcccctgtaccagtgtattccaggaaggtggcactgtgacggcaaggctgac
tgtgacaacgaggccgacgagaaaaactgcactgccaaacaatgcaaggaggatgagttt
cagtgtgccaacggccagtgtatatctgcctccttcgtctgcgacgaggacaacgactgc
tcggacggctcggatgaggcctcctgccccaaacccacctgcagcagtcgctccttccag
tgcaacaactcggtgtgcgttccagccaggtggcgctgcgacggcgaccgtgactgcgct
gatgggtctgacgagtggccggagaattgcgaaggacggcagaacaagccggcccctcgt
tgccgcagccacgagttccagtgcgcagatggggagtgcatccacagcagctggaggtgc
gacggcggcgtggactgtaaggatcgctccgacgaagcgaactgcagtcgccctgcttgc
tctcaggatcagttccggtgtctggacggcgcctgtattgccggtgctctccagtgtgac
gggatgcgtgactgcactgaccacagcgatgagctcgattgccacaaagtgaaagcatgc
gaagggcccaccatgttcaagtgtagaacaggggagtgtatcagcatggagaaagtgtgc
aacaaacaagcagactgccgggactcgtctgatgagcccgctagagaatgcgatattgac
gagtgccaggtcgacaatggtggctgttcacacaactgcagcgatttgaaagttggtttc
aattgctcctgtcccaccggatacagcctgaagatggacaagaaaacctgtgaagacatc
gatgaatgcgctgagccagacacctgcagccagatctgcatcaacctagcgggcagctac
aagtgcgactgcctggagggctaccagatcgaccccctcaccaagacgtgcaaggctcag
gcaggggttgtgccgatgctttatttcacaaataaacacgaggtgaggaggatgacgctg
gaccgcagcgagtatgtccgtctgatccctcagctgaaaaacgtggtggctctggacatt
gacatgccaaacggaagaatcttctggtccgatctcttcctgaagaaaatcttcagctcc
aggatagacgtggctggcaactcctcacaccacatcgcagtcattgaaagtggaatcgag
gcccccgagggtattgcagtggattggatccatggcaacatctactggactgacagcgct
ttgaagaccgtctctgtggcggcaacagacggcagcagaagaaagacgctgatcaccgaa
aacctggagaagccgcgagccatcgtggtcgaccccgttaataacttcatgtactggaca
gactggggcgaacaggccaaaatagagaagtgtgggttgaatggagtggatcgcttcgcc
ttggtgaccgataacattgtgtggccaaatggtatcaccctcgacgtgaccaacaatcgc
ctgtactgggtcgactcgaagctgcacactttgtccagcatcgacgtgaacggaggaaca
cgacacagtatactgttcagtgaggagcatctctcacatcccatctccctgactgttttc
gagaatcaggtgttttggacagacatggaccacagcgccgtcatgagcgccaaccgcctg
acaggaaacgatatcaaaatcttagctacggacctggatcagccggaggacatcatactg
taccacgacctcaaacagccaaccggtacgaactggtgcagagagagtaacagcatgaac
ggtggctgcgagttcctttgccttcccgcccccctgatcaaccagcgatccgcgaaattt
acctgtgcttgtccggacaacatggtcttgggacctgacaggaggaaatgcgtgacgggc
cccgtcgttccgccggccgaaggtcgatcggaggcaccgctccagcccaaagctgctacc
accacgtcgcctagtccggtcaccacagcaaccacgacagcaagacgccaaactgacccc
accagtcaggctgctgtcacggctcaaggtaacaaattgcccaaagaagcgccgtcatcc
catccagtagctctctacgttgtgttgccgataatggtcatgactctgctggtgttcgga
gcagtgctggtgtggagacactggcgcctgaagaacaccaacactatccactttgataac
cccgtgtaccagaaaaccacagaggacgagctccacatctgcaggaacggctcggacggc
tacatttatcccgag

DBGET integrated database retrieval system