KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00008349G001
Entry
GSTEN00008349G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04068  FoxO signaling pathway
tng04110  Cell cycle
tng04114  Oocyte meiosis
tng04115  p53 signaling pathway
tng04218  Cellular senescence
tng04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    GSTEN00008349G001
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00008349G001
   04114 Oocyte meiosis
    GSTEN00008349G001
   04115 p53 signaling pathway
    GSTEN00008349G001
   04218 Cellular senescence
    GSTEN00008349G001
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    GSTEN00008349G001
DNA replication proteins [BR:tng03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    GSTEN00008349G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    GSTEN00008349G001
SSDB
Motif
Pfam: Cyclin_N Cyclin_C VbhA tRNA-Thr_ED
Other DBs
NCBI-ProteinID: CAF92917
UniProt: Q4T2G5
LinkDB
Position
undetermined
AA seq 397 aa
MTSVEARAALPADENPSMGGKPAAAGPRRAALGEITNVNAAANAKRVLRAKAPGKPSCAQ
KVPAPVQVVPAPVRVVPAPVRVEEPADPPPPVSQASADVSMKEEEELCQAFSEALLTVQD
VDEDDEDQPQLCSQYVKDIYNYLRELEVQQAVRPNYMQGYEITDRMRAVLIDWLVQVHSR
FQLLQETLYLTVAILDRFLQVQPVSRRKLQLVGVTAMLVACKYEEMYAPEVGDFAYITDN
AFTKSQILEMEQVVLRSLHFQLGRPLSLHFLRRASKVANSDVERHTLAKYLMELTLLDYH
MVHYRPSEIAAAALYLSQLLLEALPWSPTQQHYSTYDEAHLKPIVQHMAKNVVLVTEGRS
KFMAVRNKYSSSKLLKISLIPQLKGAVLRNMAAPLLS
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgacgtcagtggaagctcgcgctgcgcttccagccgatgagaacccgtcgatggggggt
aaacccgcggccgcgggtccgaggagagccgctctgggagagataaccaacgttaatgcg
gctgccaacgccaagagggttctacgggccaaagctccaggaaaaccctcctgtgctcag
aaggttcctgcgccggtccaggtggttcctgcgccggtccgggtggttcctgcgccggtg
cgggtggaggagccagcagatccgccgcctcccgtttcacaggcgtccgctgacgtttcc
atgaaggaggaggaggagctgtgtcaggccttctcggaggcgctgctcaccgtccaggac
gtggacgaggacgatgaagaccagcctcagctgtgttcccaatacgtcaaagacatctac
aactacctgcgtgagctggaggtgcagcaggctgtgcggcccaactacatgcagggctat
gagatcaccgatcgcatgcgagccgtcctcatcgactggctggtccaggttcactccagg
ttccagctgctgcaggagactctgtacctcacagttgccatcctggatcgttttctccag
gtccagccggtctcccgcaggaagctccagctggtgggcgtcaccgccatgctggtggcc
tgtaaatacgaggagatgtacgcgccagaggtgggagacttcgcctacatcacagacaac
gccttcaccaagtctcagatcctggagatggagcaggtggtcctcaggagcctccatttc
cagctgggtcgccctctttccttgcacttcctgaggcgcgcgtccaaggtggcaaactct
gacgtagagagacacacgctggccaagtacctgatggagctgaccctcctggactaccac
atggttcactaccgcccgtcggagatcgccgccgcagcgctctacctgtcgcagctgctg
ctggaggcgctgccctggtccccgacccagcagcactactccacctacgacgaggcccac
ctgaagcccatcgtgcagcacatggccaagaacgtggtgctggtgaccgaggggcggagc
aagttcatggccgtgaggaacaagtactccagcagcaagctgctgaagatcagcctcatc
ccgcagctgaagggcgccgtgctcagaaacatggcggctcctctgctcagc

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00009252G001
Entry
GSTEN00009252G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04068  FoxO signaling pathway
tng04110  Cell cycle
tng04114  Oocyte meiosis
tng04115  p53 signaling pathway
tng04218  Cellular senescence
tng04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    GSTEN00009252G001
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00009252G001
   04114 Oocyte meiosis
    GSTEN00009252G001
   04115 p53 signaling pathway
    GSTEN00009252G001
   04218 Cellular senescence
    GSTEN00009252G001
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    GSTEN00009252G001
DNA replication proteins [BR:tng03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    GSTEN00009252G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    GSTEN00009252G001
SSDB
Motif
Pfam: Cyclin_C Cyclin_N
Other DBs
NCBI-ProteinID: CAF93559
UniProt: Q4T0M3
LinkDB
Position
undetermined
AA seq 353 aa
NRLASTRTDLGGKACTGTGPALKPRAALGEIGNIALNKEPLKKNVKTEATKKAKVPTKVE
KVVTVVDPPQHVLPVKPEPVQVPPEPASPTPMETSGCEPADLCQAFSDVILTTAIRDVDA
DDYDNPMLCSEYVKDIYKYLRQLEETMYMTVGIIDRFLQDHPVPKKQLQLVGVTAMFLAS
KYEEMYPPEISDFAYVTDSAYTTVQIRDMEMTVLRVLKFRLERPLPLQFLRRASKIYEVT
AEQHTLAKYLLELTMVDYEMVSFPPSIVACAALALTLRVLDVGEWDATLQHYMDYNVESL
TPVMAHIAKNVVKVNEGQTKHMAVKGKYSTSKQMRIASISQLRSSVVKDLAKL
NT seq 1059 nt   +upstreamnt  +downstreamnt
aaccgcctggcctcgacaaggacggaccttggtggaaaggcctgcacgggaaccgggcct
gctctcaaacctcgggccgccctcggagaaatcgggaatattgccctaaacaaagaaccg
ctaaagaagaatgtcaagacagaggctaccaagaaagccaaagtccccactaaagttgaa
aaggtggtgactgtcgttgacccgccacaacatgtcctccctgtaaaaccagagcctgtg
caggttcctcctgaaccggcatctcccactccgatggagacctcgggctgtgagccagca
gacctctgtcaagcgttttcagacgtcattcttaccaccgctattagggatgtggatgcc
gacgattatgacaaccctatgctctgcagtgaatatgtaaaggacatctacaagtacctc
cggcaacttgaggagaccatgtacatgactgtgggaataattgaccgctttcttcaggac
cacccagtccccaagaagcagctgcaacttgttggcgtcacagctatgtttcttgcttcc
aaatacgaggagatgtatccaccagagatttcagattttgcttacgtgactgacagcgcc
tacaccaccgtgcagatcagggacatggaaatgaccgtcctcagagtgctcaaattcaga
ctggagcgcccccttcccttacagttcctcagaagggcttcaaagatatatgaggtgact
gctgagcagcacacactggcaaagtacctcctggagctcactatggtcgactacgagatg
gtttcttttccaccttctattgtggcgtgtgctgctttggcactgacgctgagggtcttg
gatgttggcgaatgggatgccacgctgcagcactacatggactacaacgtagagagtttg
actcctgttatggcacacatagccaaaaatgtcgtgaaggttaatgaagggcaaaccaag
catatggctgttaaaggaaagtactctacttcgaagcagatgaggattgccagcatttca
cagctaaggtcttcagtggtgaaagacttggcaaaactt

DBGET integrated database retrieval system