KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00008621G001
Entry
GSTEN00008621G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
tng04137  Mitophagy - animal
tng04140  Autophagy - animal
tng04210  Apoptosis
tng04621  NOD-like receptor signaling pathway
tng05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    GSTEN00008621G001
   04137 Mitophagy - animal
    GSTEN00008621G001
  09143 Cell growth and death
   04210 Apoptosis
    GSTEN00008621G001
   04115 p53 signaling pathway
    GSTEN00008621G001
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    GSTEN00008621G001
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    GSTEN00008621G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tng01009]
    GSTEN00008621G001
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tng03036]
    GSTEN00008621G001
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tng02000]
    GSTEN00008621G001
Protein phosphatases and associated proteins [BR:tng01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GSTEN00008621G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    GSTEN00008621G001
Transporters [BR:tng02000]
 Other transporters
  Pores ion channels [TC:1]
   GSTEN00008621G001
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-ProteinID: CAF93123
UniProt: Q4T1V9
LinkDB
Position
undetermined
AA seq 211 aa
NRELVIFYIKYKLSQRNYPLSHIVEPSSRTEGQFGTTQSNGTFNGASPGTPPAPSQHQQS
LTSLDAVKEALRDTGNEFELRYTCAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGR
IVGLFAFGGALCVECVEKEMNPLVGRIIEWMTVYLDNHIQPWIQSQGGWERFAELFGQDA
AAESRRSQERFRNGLFLGMSLAAGIALGSFI
NT seq 633 nt   +upstreamnt  +downstreamnt
aacagagaactggtcattttctacattaaatacaaactttcccaaagaaactaccctttg
agtcacattgtagagccttcaagtaggactgaagggcagtttggaaccacccagtccaat
ggaacttttaatggggcaagtcctggaacccccccagcaccctcccagcaccagcagtca
ttgacaagtctggacgcagtcaaggaagccctccgggacaccggcaatgaatttgagctg
cggtacacctgcgcgttcagtgacctgcacaaccagctccacatcacgccagccacggct
taccaaagttttgagaacgttatggatgaggtgtttcgggatggagtcaactgggggcgg
atagtgggcctttttgccttcggtggtgccctgtgtgtggagtgtgtggagaaggagatg
aatcctctggttggccggatcatagagtggatgacggtctatctggacaaccacatccag
ccctggatccagagtcaaggaggatgggaacgttttgctgaactcttcgggcaggacgcg
gctgcagaaagccgcaggtcccaggagcgattccgaaacgggctgtttctgggcatgagt
ctggcggcagggatcgccctcggctccttcatc

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00014059G001
Entry
GSTEN00014059G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
tng04137  Mitophagy - animal
tng04140  Autophagy - animal
tng04210  Apoptosis
tng04621  NOD-like receptor signaling pathway
tng05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    GSTEN00014059G001
   04137 Mitophagy - animal
    GSTEN00014059G001
  09143 Cell growth and death
   04210 Apoptosis
    GSTEN00014059G001
   04115 p53 signaling pathway
    GSTEN00014059G001
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    GSTEN00014059G001
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    GSTEN00014059G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tng01009]
    GSTEN00014059G001
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tng03036]
    GSTEN00014059G001
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tng02000]
    GSTEN00014059G001
Protein phosphatases and associated proteins [BR:tng01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GSTEN00014059G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    GSTEN00014059G001
Transporters [BR:tng02000]
 Other transporters
  Pores ion channels [TC:1]
   GSTEN00014059G001
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-ProteinID: CAF96873
UniProt: Q4SR59
LinkDB
Position
11
AA seq 218 aa
MSYDNRELVEYFLGYKLAQRNYPSSLLRPQEPDGWTEGDKKSPAAVNGLLIRNRSRSGAS
ASTGAGVEAVHAALRDSAEEFEKLFAQAFSDLSSQLVITPDTAYQSFKNVMDEVFKDGVN
WGRIVGLFAFGGVLCVECVEKDASELVCRIADWMTIYLDEHINPWIQSQGGWDSFAQIFG
KDAAAEGRRAREALSRWMLGGLALLMGVLVGVFIVKKH
NT seq 654 nt   +upstreamnt  +downstreamnt
atgtcgtatgataacagagagctggtggagtacttcttaggctacaaactggctcagagg
aactacccgtcctctctgctgagaccccaggagcctgatggatggacggagggagacaag
aagagccccgccgccgtaaacggtctgctgatccggaacaggagcaggagcggagcgtcc
gcgtccacgggtgccggcgtcgaggccgtgcacgcggctcttcgggactcggccgaggag
tttgagaagctctttgctcaagcgttcagcgacctgtcctcgcagctggtcatcactcct
gacacagcttaccagagcttcaagaacgtgatggacgaggtgttcaaggacggcgtcaac
tggggacggattgtggggctttttgccttcggcggcgtgctctgcgtggaatgtgtggag
aaggacgccagcgagctggtttgccgcattgcagactggatgaccatttacctggatgag
cacattaacccgtggatccagagtcagggaggatgggacagctttgctcagattttcggg
aaggacgcggcggcggaggggaggagagctcgcgaggcgctgagccgatggatgctgggc
ggcttggcgctgctgatgggagtcctggtcggagttttcatcgtgaagaaacat

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00020506G001
Entry
GSTEN00020506G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
tng04137  Mitophagy - animal
tng04140  Autophagy - animal
tng04210  Apoptosis
tng04621  NOD-like receptor signaling pathway
tng05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    GSTEN00020506G001
   04137 Mitophagy - animal
    GSTEN00020506G001
  09143 Cell growth and death
   04210 Apoptosis
    GSTEN00020506G001
   04115 p53 signaling pathway
    GSTEN00020506G001
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    GSTEN00020506G001
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    GSTEN00020506G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tng01009]
    GSTEN00020506G001
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tng03036]
    GSTEN00020506G001
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tng02000]
    GSTEN00020506G001
Protein phosphatases and associated proteins [BR:tng01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GSTEN00020506G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    GSTEN00020506G001
Transporters [BR:tng02000]
 Other transporters
  Pores ion channels [TC:1]
   GSTEN00020506G001
SSDB
Motif
Pfam: Bcl-2 BH4
Other DBs
NCBI-ProteinID: CAG01669
UniProt: Q4SCG3
LinkDB
Position
undetermined
AA seq 207 aa
MSHTNRELVEFYLNYKLSHSNFLTSLRASADAWQSPRISRRDRSGASPSSDAGRRAVKAV
LRKATDDFEKKLTRACGDLSSYLPSKISHQNFNNTMDQIFEGNVHWGVVIGLFVVGGAMC
VQCVRNNHEELVCHIADWMTAYLDEHLEPWIQRQGGWEDFTRRYETVDERSQFERGAKLC
FLTLVLLVGGFVIFRKYNVFHRLLRFL
NT seq 624 nt   +upstreamnt  +downstreamnt
atgtctcacactaacagagagctggtggagttctatctgaactacaaactgtctcacagc
aacttcctgacgtctctgcgggcatcagcggacgcgtggcagagccccaggattagccgc
agagaccgcagcggagcctctccgtcctcggacgctggtcgccgggctgtgaaggcagtt
cttcggaaggcgacggatgattttgagaagaagctcactcgagcatgtggtgatctctcc
tcgtacttgccctccaagatcagccaccaaaactttaacaacacaatggaccagattttc
gaaggcaacgtgcactggggagtcgtcattggtctgttcgtggtaggcggcgccatgtgt
gtgcagtgtgttaggaacaaccacgaggaactggtctgccacattgcagactggatgacg
gcctacttggatgagcatcttgagccctggatccagagacaaggaggctgggaggacttt
acccggagatatgaaacagttgatgaacggagccaatttgaaagaggagcgaagctttgc
tttctgactctggtgctgctggttggggggtttgtcatttttaggaaatataacgtgttc
catcgcttactgcgttttctgtag

DBGET integrated database retrieval system