KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00009913G001Help
Entry
GSTEN00009913G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00010  Glycolysis / Gluconeogenesis
tng00053  Ascorbate and aldarate metabolism
tng00071  Fatty acid degradation
tng00280  Valine, leucine and isoleucine degradation
tng00310  Lysine degradation
tng00330  Arginine and proline metabolism
tng00340  Histidine metabolism
tng00380  Tryptophan metabolism
tng00410  beta-Alanine metabolism
tng00561  Glycerolipid metabolism
tng00620  Pyruvate metabolism
tng01100  Metabolic pathways
Module
tng_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSTEN00009913G001
   00053 Ascorbate and aldarate metabolism
    GSTEN00009913G001
   00620 Pyruvate metabolism
    GSTEN00009913G001
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GSTEN00009913G001
   00561 Glycerolipid metabolism
    GSTEN00009913G001
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GSTEN00009913G001
   00310 Lysine degradation
    GSTEN00009913G001
   00330 Arginine and proline metabolism
    GSTEN00009913G001
   00340 Histidine metabolism
    GSTEN00009913G001
   00380 Tryptophan metabolism
    GSTEN00009913G001
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GSTEN00009913G001
Enzymes [BR:tng01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     GSTEN00009913G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CAF94009
UniProt: Q4SZC3
LinkDB All DBs
Position
undetermined
AA seq 518 aa AA seqDB search
MLRTLFLRALPRLGRPAVCRYSAAAIPVPNTRPEVHFNKLFINNEWHDAVSGKTFPTINP
STGEVICQVAEADEADVNKAVKAARDAFRLGSPWRRMDASHRGLLLSRLADAIEKDSAYL
AELETLDNGKPYAVAYAVDLPNVVKCLRYYAGWADKWEGKTIPIDGDFFCYTRHEPVGVC
GQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYVANLVREVGFPEGVVNILA
GMGPTAGAAIARHSDIDKVAFTGSTEVGHMIQQASGSSNLKKVTLELGGKSPNIILSDAD
MQDAVEQSHFALFFNQGQSLCAGSRTYVQEDVYDEFVQRSVERAKRRLVGDPFDLKTEQG
PQVDLEQFNKILGYISTGKREGAKLMCGGGAAADKGYFIQPTVFGDVQDNMAIAREEIFG
PVMQIMKFKSLEEVLERANDTKYGLAAAVFTKDIDKAHYISAGLRAGTVWINCYDVFGSQ
APFGGYKASGIGRELGEYGLDNYTEVKTVTIRVPQKNS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcaccctgttcctccgggctcttcctcgcctcggccggccagccgtctgccgc
tactccgccgccgccatcccggtgccgaacacccggccggaggtccacttcaacaagctg
ttcatcaacaacgagtggcacgacgccgtcagcgggaaaaccttccccaccatcaacccg
tccaccggcgaggtcatctgtcaggtcgccgaggccgacgaggctgacgtaaacaaggcc
gtgaaagcggcgcgcgatgccttcaggctggggtcgccgtggcgacggatggacgcctcc
caccgcggcctgctgctgagccgtctggcggacgccatcgagaaggattctgcctacctg
gcggaactggagacgctggacaacgggaagccctacgcggtggcctacgcggtggacctg
cctaacgtggtgaagtgtttgaggtactacgcaggctgggccgacaaatgggaggggaag
accattcccatcgacggagacttcttctgctacacccggcacgagcccgtcggggtctgc
gggcagatcatcccgtggaacttccctctgctgatgcaggcctggaagctgggccccgcc
ctggccaccggcaacaccgtggtgatgaaggtggccgagcagacgccgctgaccgccctc
tacgtggccaacctggtccgagaggtgggttttcctgaaggtgtggtgaacatcctggcc
gggatggggccgacagccggggctgcgatcgccaggcactcggacatcgacaaggtggcc
ttcactggatccacagaggtgggtcacatgattcagcaggcctcgggcagcagcaacctg
aagaaggtcaccctggagctgggagggaagagcccgaacatcatcctgtctgacgccgac
atgcaggacgccgtggagcagtcccacttcgccctgttcttcaaccagggccagtcgctg
tgcgccggctcgcggacctacgtgcaggaggacgtctacgatgagtttgtgcagcgcagc
gtggagcgagccaagaggcggttggtcggagaccccttcgacctgaagacggagcagggg
cctcaggtggacctggagcagttcaacaagatcctgggctacatcagcacggggaaaaga
gagggagccaagctgatgtgtggaggcggcgcggccgctgacaaaggctacttcatccag
cccacggtgttcggagacgtgcaggacaacatggccatagccagggaggagatctttggt
ccagtgatgcagatcatgaagttcaagtcgctggaggaggtgttggagcgagccaacgac
accaaatacggcctggcagcagccgtgttcaccaaggacatcgacaaggcgcattacatc
tccgccgggctgcgtgcaggcaccgtctggattaactgctacgacgtgttcgggtcccag
gctcccttcgggggctacaaggcttcgggaatcggccgggagctgggagaatacggcctg
gacaactacacggaggtgaagacggtgaccatcagagtgccccagaagaactcc

DBGET integrated database retrieval system