KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00010050G001
Entry
GSTEN00010050G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K19748  RAB6-interacting golgin
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00010050G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tng04131]
    GSTEN00010050G001
Membrane trafficking [BR:tng04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    GSTEN00010050G001
SSDB
Motif
Pfam: Transcrip_act SLATT_5
Other DBs
NCBI-ProteinID: CAF94108
UniProt: Q4SZ24
LinkDB
Position
undetermined
AA seq 264 aa
MSSWAGFSDEELRKIQHKDSPAPAAAARGRRAAPANRSRQQVQREEALQLAVRKNHTVAS
NGLQPEQQLARPPANEKLGPWTADLAGKETDQPEPSDVSEQHQPPAEETRPGVQELEKEE
VELREKTRLEQLQQEQKVIEERNKRTKALLAKTIAEKSKQTQEEAVKLKRIQRELQTLDD
MVSSDISILRDRIEQASWDYSAARKRYEKAESEYVTAKLDLHRKTEVKEQLTEHLYAIIQ
QNELRKAEKLQELMLQLQLHAAEA
NT seq 792 nt   +upstreamnt  +downstreamnt
atgagcagctgggccggtttttctgacgaggagttacggaagattcaacacaaagactct
ccggcgcccgcagcggccgcccgcggtcgtagagcggctccggcgaaccgcagcaggcag
caggttcagcgggaggaagccttgcagctcgccgtccggaagaaccacacagtggcgtcc
aacgggttgcagccggagcagcagctcgccagaccaccggcgaacgagaaactgggtcct
tggacagcagatctggctggtaaagagacggatcagccggaaccttccgatgtgagcgag
cagcatcagccgcctgcggaggagacgcgtccgggcgtccaagagctggagaaggaggag
gtggaactacgagagaagacacgtctggagcaactgcagcaagaacagaaggtcatagaa
gagaggaacaaacggaccaaagctctgctggctaaaactattgcagaaaagtcaaagcag
actcaggaagaagctgtgaagctcaaaagaatccagagggagctgcagactctggacgac
atggtgtccagtgacatcagcatcctgagggaccggatcgagcaggccagctgggactac
tctgctgccaggaagcgttacgagaaggcggagtctgagtacgtgacggccaagctggac
ctccacaggaagacggaggtgaaggagcagctgacggagcacctgtacgccatcatccag
cagaacgagctgaggaaggcggagaagctgcaggagctgatgctgcagctgcagctgcac
gccgccgaggcc

DBGET integrated database retrieval system