KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00011294G001
Entry
GSTEN00011294G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00562  Inositol phosphate metabolism
tng01100  Metabolic pathways
tng04068  FoxO signaling pathway
tng04070  Phosphatidylinositol signaling system
tng04115  p53 signaling pathway
tng04140  Autophagy - animal
tng04150  mTOR signaling pathway
tng04218  Cellular senescence
tng04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    GSTEN00011294G001
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    GSTEN00011294G001
   04070 Phosphatidylinositol signaling system
    GSTEN00011294G001
   04150 mTOR signaling pathway
    GSTEN00011294G001
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    GSTEN00011294G001
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00011294G001
   04218 Cellular senescence
    GSTEN00011294G001
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    GSTEN00011294G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tng01009]
    GSTEN00011294G001
Enzymes [BR:tng01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     GSTEN00011294G001
    3.1.3.48  protein-tyrosine-phosphatase
     GSTEN00011294G001
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     GSTEN00011294G001
Protein phosphatases and associated proteins [BR:tng01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    GSTEN00011294G001
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase APG12
Other DBs
NCBI-ProteinID: CAF94889
UniProt: Q4SWU3
LinkDB
Position
undetermined
AA seq 404 aa
MTSLIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPADRLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERNYDSAKFNCQVAQFPFEDHNPPQLELIRPFCEDLDQWLSKDEQHVA
AIHCKAGKGRTGVMICAYLLHRGRFQEAQEALDFYGEVRTRDKKGVTIPSQRRYVIYYSF
LLRNQLMYKPVALLFHKMMFETIPMFTGGTCNPQFVVYQLKVKIYTSSPSLIRREDKLMV
FEFPQPLPVCGDIKVEFFHKQNKMMKKEKMFHFWVNTFFIPAPEENFSKLENGSSSTLRD
LQQLGLLVGLDGSERDQLVLTLTKNDLDKANKDKANRNFSPNFKVKLFFSKTVEEGGATC
EASSPPPPVASDGGDVEPDHYHYSDTTDSETENEDDQHHHITNL
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgacttctttaatcaaggaaatagtcagcaggaataaaagacgataccaggaggacggc
ttcgacctggacctgacctatatctaccccaacatcatcgccatggggttccccgccgac
cggctggagggcgtctacaggaacaacatcgatgacgtggtcaggttcctggactccaaa
cacaagaaccactacaagatctacaacctatgtgctgaaagaaactacgactcagcaaag
ttcaactgtcaagtggcccagttccccttcgaggaccacaaccccccccagctggagctg
atccggcccttctgtgaggatctggaccagtggctgagcaaagacgagcagcacgtggcc
gccatccactgcaaggctggaaaaggccgcacgggcgtgatgatctgtgcctacctgctg
caccgaggccgcttccaggaggcccaggaggccctggacttctacggagaagtcaggacc
cgggacaagaagggtgtcaccatcccgagtcagcggcgttacgtcatctattacagcttc
ctgttgagaaaccagctgatgtacaagcccgtagctttgctcttccacaagatgatgttt
gagaccatccccatgttcactggaggaacctgcaacccccagtttgtggtctaccagctg
aaggtgaagatctacacctccagtccgagtctcatccgccgtgaggacaaactgatggtc
tttgagtttcctcagccacttcctgtctgtggtgacatcaaggtggagttcttccacaag
cagaacaagatgatgaagaaggagaagatgttccacttctgggtgaacaccttcttcatc
ccagccccagaggagaacttcagcaagctggagaacggcagcagcagcacgctgagggac
ctgcagcagctgggcctcctggtggggctggacggctccgagcgggaccagctggtgctc
acgctcaccaagaacgacctggacaaggccaacaaggacaaggccaacaggaacttctcg
cccaacttcaaggtcaaactcttcttctccaagacggtagaagaaggaggagccacctgc
gaggccagcagcccgccgccgccggtggcgtctgacggcggggacgtggagccggatcac
taccactactcagacaccaccgactcggagacggagaacgaggacgaccagcaccaccac
atcaccaacctc

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00024921G001
Entry
GSTEN00024921G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00562  Inositol phosphate metabolism
tng01100  Metabolic pathways
tng04068  FoxO signaling pathway
tng04070  Phosphatidylinositol signaling system
tng04115  p53 signaling pathway
tng04140  Autophagy - animal
tng04150  mTOR signaling pathway
tng04218  Cellular senescence
tng04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    GSTEN00024921G001
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    GSTEN00024921G001
   04070 Phosphatidylinositol signaling system
    GSTEN00024921G001
   04150 mTOR signaling pathway
    GSTEN00024921G001
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    GSTEN00024921G001
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00024921G001
   04218 Cellular senescence
    GSTEN00024921G001
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    GSTEN00024921G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tng01009]
    GSTEN00024921G001
Enzymes [BR:tng01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     GSTEN00024921G001
    3.1.3.48  protein-tyrosine-phosphatase
     GSTEN00024921G001
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     GSTEN00024921G001
Protein phosphatases and associated proteins [BR:tng01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    GSTEN00024921G001
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-ProteinID: CAG05033
UniProt: Q4S2U9
LinkDB
Position
17
AA seq 440 aa
MAAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDAAKFNCRGRPPDHQAPRPPPCSPLTGPHMSSLRPSVAQYPFED
HNPPQLELIKPFCEDLDLWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLDAQEAL
DFYGEVRTRDKKGVTIPSQRRYVYYYNYLLKNQLEYKPVALLFHKMVFETLPMFSGGTCN
PQFVVYQLKVKIHTSNPSHTRREDKHMFFEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFH
FWVNTFFIPGPEESRDKLENGAVNNADSQQGVPAPGQGQPQNAECRESDRDYLILTLSKN
DLDKANKDKANRYFSPNFKVKLYFSKTVEEPSNSEASTSTSVTPDVSDNEPDHYRYSDTT
DSDPENEPFDEEQHTQITKV
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggctgctattataaaagaaatggtcagccggaacaaaaggagatatcaagaggatggg
ttcgacttggacttaacatatatctacccaaacattatagctatgggctttccagcggag
cgactcgaaggcgtgtacagaaacaatatagacgatgtagtacggtttttggactcgaag
cataaaaaccattataaaatctacaacctctgtgcagaaagacactacgacgctgccaaa
tttaactgcagaggtaggccgcccgaccaccaggcgcctcgcccgccgccctgctctcct
ctcaccggtccccatatgtcttctctccgtccctcagttgcacagtatcccttcgaagac
cacaaccctcctcagctggagctgattaagccgttttgtgaagacctggacctgtggctc
agcgaggacgacaatcacgtggcggccatccactgtaaggctgggaagggacgcaccggg
gtcatgatctgcgcctatctcctccatcggggcaagttcctggacgcccaagaagcgctc
gatttttacggggaagtcaggacaagggacaagaagggagtaacgatcccgagccagcgc
cgttacgtctactactacaactacctactgaagaaccagctggagtacaagcccgtggcg
ctcctcttccacaaaatggtgttcgagactctccccatgttcagcgggggcacctgcaat
ccacagtttgtggtgtaccagctgaaagtgaagattcacacgtcgaacccgtctcacacg
cgacgtgaggacaagcacatgtttttcgagttcccccagccgctacccgtttgtggagac
atcaaagtggagttcttccataaacagaataagatgatgaagaaggacaaaatgtttcat
ttctgggtgaacacgtttttcatccccggaccagaagagagcagggacaagctggagaac
ggggcggtgaacaacgcggacagtcagcagggggtaccagcaccaggtcaaggccagcca
cagaacgccgaatgcagggaaagcgacagggactacctcatcctgacgctcagtaaaaat
gatctggacaaagctaacaaggataaagctaaccgctacttttcacctaacttcaaggtg
aaattgtatttctcgaagaccgtggaggagccctcaaactccgaggcaagcacttcgaca
tccgtcaccccggacgttagcgacaatgagccagaccattatcgatactctgacaccact
gactctgatccggaaaatgaaccttttgacgaagagcagcacacgcaaatcactaaagtg
tga

DBGET integrated database retrieval system