KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00011727G001
Entry
GSTEN00011727G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K06626  G1/S-specific cyclin-E1
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04110  Cell cycle
tng04114  Oocyte meiosis
tng04115  p53 signaling pathway
tng04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00011727G001
   04114 Oocyte meiosis
    GSTEN00011727G001
   04115 p53 signaling pathway
    GSTEN00011727G001
   04218 Cellular senescence
    GSTEN00011727G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tng03032]
    GSTEN00011727G001
   03036 Chromosome and associated proteins [BR:tng03036]
    GSTEN00011727G001
DNA replication proteins [BR:tng03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    GSTEN00011727G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    GSTEN00011727G001
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-ProteinID: CAF95182
UniProt: Q4SW00
LinkDB
Position
undetermined
AA seq 360 aa
MTKKKQRDCELGWNPDPGYASPHRWIPTPDLEEDQPVTLINAGFPHYNLNSIFTTPVRCA
PLPTLCWASKDVVWSNMLEKDKTYTRDVHMMEKHPHLQPKMRAILLDWLMEVSEVYKLHR
ETYHLAQDYFDRFMATQRNVFKSTLQLIGITCLFIAAKVEEMYPPKVHQFAYVTDEACTE
DEILSMEIIIMKELQWSLSPQTPISWLNVYMQVAYLKETDELLLPRYPQATFIQIAELLD
LCMLDVRCLEFSNGVLAASALFHFSSLELVETVSALKRAELEECVRWMVPFAMALREVGG
SSMKTFPGIPADDTHNIQTHAPYMTWLDKAYSYQDVDLEQRGNCPVPSGILTPPLSIEKT
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgacaaagaagaagcagcgtgactgcgagctgggctggaatcccgatcccgggtatgca
agtccccacaggtggatccccactccggatctggaagaagaccaaccggttactctgata
aatgcaggctttcctcactataacttaaacagcatattcaccacccccgtgcgctgtgcc
ccgcttcccactttgtgctgggccagtaaagatgtggtgtggagcaacatgttggagaaa
gataagacctatactagagatgtccacatgatggagaaacaccctcatctgcagcccaaa
atgagggccattcttctggattggctcatggaggtgagcgaagtgtacaagctgcacagg
gagacgtaccacctggcccaggactacttcgatcgcttcatggccacacagagaaacgtc
ttcaagtccacgttgcagctcatcggcatcacgtgcctcttcatcgcggccaaagttgaa
gagatgtatccaccaaaggtccaccagtttgcctacgttacagatgaagcttgtacagaa
gacgaaattctcagtatggagatcattattatgaaggagctgcaatggagcctgagtcct
cagactcccatctcctggctcaatgtttacatgcaggtggcctatctgaaagagacggac
gagctgcttctgccccggtacccccaggctaccttcatacagatcgcagagttgctggac
ctgtgcatgcttgacgtacggtgcctggagttttccaacggcgtcctcgccgcttcggcc
ttgtttcacttctcgtctctggagctggtggagaccgtctcggctctgaagagggcggag
ctggaggagtgtgtgaggtggatggtgccttttgcgatggcgctccgcgaggttggaggc
tcctccatgaaaacgttcccgggaatacccgcagacgacacgcacaacatccagacccac
gcaccctacatgacgtggctggacaaggcctactcctaccaggacgtggacctggagcag
cgcgggaactgtcccgtcccttcaggcatcctcacgccgccgctcagcattgaaaaaact

KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00024300G001
Entry
GSTEN00024300G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K06626  G1/S-specific cyclin-E1
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04110  Cell cycle
tng04114  Oocyte meiosis
tng04115  p53 signaling pathway
tng04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00024300G001
   04114 Oocyte meiosis
    GSTEN00024300G001
   04115 p53 signaling pathway
    GSTEN00024300G001
   04218 Cellular senescence
    GSTEN00024300G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:tng03032]
    GSTEN00024300G001
   03036 Chromosome and associated proteins [BR:tng03036]
    GSTEN00024300G001
DNA replication proteins [BR:tng03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    GSTEN00024300G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    GSTEN00024300G001
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-ProteinID: CAG04545
UniProt: Q4S487
LinkDB
Position
undetermined
AA seq 262 aa
SWASSEDVWISMLNKELKYFHDSSYLQRHPRLQPKMRAILLDWLLEVSEVYSLHRQTAYL
AQDFFDRFMLTQEDVSKEHLQLLGITALFIASKMEEIYPPKICEFAYVTDGACDMWDIQQ
TELLMLKALEWNLCPETAISWLKLYAQVEAQKDQENFLVPQFSPDTYIQITQLLDLCMMD
VAWLGYSYSVLAAAAFCHFSTFEVVHKVSGLTWDSVAPCVRWMTPFMDTLRAEATPTLKV
FPAVKTDDRHNIQTHVAYLELL
NT seq 786 nt   +upstreamnt  +downstreamnt
agctgggccagttctgaggacgtgtggatcagcatgctcaacaaggagctcaagtacttc
cacgacagcagctacctgcagcggcacccccggctgcagcccaagatgagggccatcctg
ctggactggctgctggaggtgagcgaggtgtacagtctgcaccggcagacggcgtacctg
gcgcaggacttcttcgaccgcttcatgctgacgcaggaggacgtcagtaaggagcacctg
cagctgctgggcatcacggcgctcttcatcgcctccaagatggaggaaatttaccctccg
aagatctgcgagttcgcctacgtgacggacggcgcctgcgacatgtgggacatccagcag
acggagctgctcatgctgaaggcgctggagtggaacctgtgtccggagacggccatctcc
tggctgaagctctacgctcaggtggaggcccagaaggaccaggagaacttcctggttccg
cagttctctccagacacctacatccagatcacacagctgctggacctgtgcatgatggac
gtggcctggctgggctacagctacagcgtcctcgccgccgccgccttctgtcacttctca
acattcgaggtggttcataaggtttcgggcctgacgtgggacagtgtggcgccctgcgtc
cggtggatgacgcccttcatggacacgctgcgagctgaggccacgcccaccctcaaagtc
ttcccggcggtcaaaaccgacgacagacacaacatccagacccacgtggcctacctggag
ctgctg

DBGET integrated database retrieval system