KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00012482G001
Entry
GSTEN00012482G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10140  DNA damage-binding protein 2
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng03420  Nucleotide excision repair
tng04115  p53 signaling pathway
tng04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:tng00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    GSTEN00012482G001
  09124 Replication and repair
   03420 Nucleotide excision repair
    GSTEN00012482G001
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00012482G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:tng04121]
    GSTEN00012482G001
   03400 DNA repair and recombination proteins [BR:tng03400]
    GSTEN00012482G001
Ubiquitin system [BR:tng04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     GSTEN00012482G001
DNA repair and recombination proteins [BR:tng03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      GSTEN00012482G001
SSDB
Motif
Pfam: WD40 ANAPC4_WD40
Other DBs
NCBI-ProteinID: CAF95721
UniProt: Q4SUG1
LinkDB
Position
undetermined
AA seq 485 aa
MRNKSDRPNASTNKVAKRSDSSASSQPKTPKSKMQSWKREAPEPAATNRSVRGSILHYIY
QNTLGQSLRSQTRRCLQEPFVRSLASYHFHGATCPFDRRVTCLEWHPTRPTTLAAASKGG
DLYLWDYMRPAKANFIQGNGAGDSIGGMKFCPMDPSKIYVASGEGRLDLMSFEGCTPTVL
ATNVDSYHDNHVCFWFCCVDVSVSRQMLVTGDNVGQLLLLSLDGQKIFKEKLHKAKVTHA
EFNSRCDWLLATASVDHTVKLWDLRNMKDKKSFLHELPHEKAVNSAYFNPLDCSKLLTTD
QYDQIRVYSSSDWSTPQQIIRHPHRHFQHLTPIKATWHPVYDLIVAGRYPDNRICLSDKR
TVDLYDANTAELVCQLQDPTVAGIKSINKFNPLGDVIGSGMGVTVVLWNRNESLLNQLEE
EETSTPMGGRGNHWRGEQPPRRGRGGPSGDGKTTKRKLASPEKTGARSKTTTSNTREKQP
QRRKT
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgagaaataaatcggacagaccaaatgcgtcaacaaacaaagtggcaaagaggtccgac
agctcggcttcgtcgcagcctaaaacgcctaaaagcaaaatgcagtcgtggaaacgagag
gctccggagcctgccgcgaccaacaggagtgtccgtggaagcatcctgcactacatttac
cagaacacactggggcagagcctgcgttcgcagacgagacggtgtcttcaggagccgttt
gttcgctcgctggcctcttatcacttccacggtgccacctgcccttttgaccgcagggtc
acctgtctggagtggcaccccacccgtcccaccaccctggccgcagcatcaaagggtgga
gatttgtatctgtgggactacatgaggcccgccaaagccaacttcatccaggggaacgga
gccggagattctatcggggggatgaagttctgtcccatggatccttctaaaatctacgtg
gcctctggtgagggcagactggacctgatgagcttcgagggttgcacacccacagtgctg
gcaacaaatgtagacagctaccacgataaccacgtttgcttttggttctgctgtgttgat
gtgtctgtgagcagacagatgttagtgactggagacaatgtgggacagctgctgctgctg
agtttggacggtcaaaagattttcaaggaaaagttgcacaaagccaaagtgacccacgcc
gagttcaattcccgctgtgactggttgttggccacagcttcagtcgaccacacggtcaaa
ctctgggatttgagaaacatgaaagacaagaaaagtttcctccatgaacttcctcacgag
aaagccgtcaactcggcctatttcaacccgctcgactgctccaagttactgaccacagat
cagtacgatcagatccgcgtctactcgtcctccgactggtccactcctcaacaaatcatc
cggcatcctcacaggcactttcagcatctcacacccatcaaggccacgtggcatccggtc
tacgacctgatcgtggcaggccgctaccctgacaaccgcatttgcctcagtgataagagg
accgtcgacttgtatgacgccaacacagcggaacttgtgtgtcagctgcaggatcccaca
gtagcagggatcaaatctattaataaattcaatcctctgggcgatgtgattggctctggg
atgggggtgacggtggtgctctggaacagaaacgagtccctgctcaatcagctggaagag
gaagagacgtccacgccgatgggcggacgcgggaaccactggagaggcgagcagccccct
cgccgaggcagagggggtccctctggggacgggaaaacgacgaagaggaagcttgcctct
ccggaaaaaacaggggccagaagcaaaaccacaacaagcaacacgcgagaaaaacaaccg
cagaggaggaagacatga

DBGET integrated database retrieval system