KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00013010G001
Entry
GSTEN00013010G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10137  zinc finger, matrin type 3
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00013010G001
SSDB
Motif
Pfam: zf-met zf-C2H2_jaz TUTase zf-C2H2_2 zf-U1
Other DBs
NCBI-ProteinID: CAF96100
UniProt: Q4STD2
LinkDB
Position
undetermined
AA seq 360 aa
MSVQLSSARPAQPLRLPPMAHVPPNAALAQPLGLPPLNPAHALVPPPAVAPGSGQLPLPP
SPLSSPPAPSPEAPQVPQRLPPPAIIPAPVPCLISSPLLGQGALASEQPQDEDPPLGAEE
QEDSLGLGELCKPLYCKLCNVTLNSAQQAQAHYQGKNHSKKLRNFYAGSQQPPAIRIPDA
LEGAGQTALSSGSNDGDAGRQALYKGATRVILATENDYCKLCDASFSSLAVAQAHYQGKN
HAKKLRLAEAQQNANNTESANDAAPKRARRDTSEYRLVKSRRSPQLPASMSGPYYNPRPR
QRIPRDLAMCVTPSGQFYCSMCNCGAEQEADFRQHLESKQHKAKVSELRYRHEMENLGYS
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgtctgtccagctgagctcagcccggccagctcagcctctgaggcttccaccgatggca
cacgtgcctccaaacgcggccctcgcacagccgctggggcttccacctctgaaccccgct
cacgcactggtgcccccccctgcagtagcgcctggaagcggccagttgccgctccctccc
agtccactgtcctcacctccagctccaagtccagaagcgccacaggtgccccagaggctc
ccaccgccagccatcatccccgccccggtgccctgtctcatttccagccctctgctgggt
cagggagccctagctagcgagcaaccccaagacgaagaccccccactgggtgcagaggag
caagaggactccctgggcctgggggaactttgtaaaccactgtactgcaaactctgcaat
gttacactcaactctgctcagcaggcacaggctcactaccagggaaaaaatcacagcaaa
aagctaagaaatttctatgctggcagtcaacagcctcctgccatcagaatccctgacgca
ctcgagggggctggccagacagcactaagctcaggatccaacgacggtgacgcagggagg
caggctctgtataaaggggcgacccgggtcatcctggccacagaaaatgactactgtaag
ctgtgtgacgcctctttcagctcgctggcagtcgctcaggctcactatcaaggcaagaac
cacgccaagaagctgcggctcgccgaagcccagcagaacgccaataacacggaaagcgcc
aatgacgcagctcccaaaagggccaggagagataccagcgagtacagactggtgaagagc
cgccgcagcccgcagctgcctgcttccatgtcagggccgtactacaacccccggccgcgg
cagcgcatccccagggacctggccatgtgcgtgactcccagcggacagttctactgctcc
atgtgcaactgcggagccgagcaggaggcagatttcaggcagcatctggagagcaagcag
cacaaggccaaagtgtccgagctacgataccgccacgagatggagaacctggggtacagc

DBGET integrated database retrieval system