KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00013984G001
Entry
GSTEN00013984G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10127  protein Mdm4
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    GSTEN00013984G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:tng04121]
    GSTEN00013984G001
Ubiquitin system [BR:tng04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    GSTEN00013984G001
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP
Other DBs
NCBI-ProteinID: CAF96818
UniProt: Q4SRB4
LinkDB
Position
11
AA seq 529 aa
ITMSSLSAEPPSSSSSCRTLPGEGNQVQPKAPLLQILRVAGAQEEVFTLKEVMHYLGQYI
MGKQLYDKQRQHIVHCQDDPLGELLEVESFSVKNPRYSTTTRMVNATNGRLCFFLLSEKN
KRVYFNVCILFHSPVYEMLKKYLVVLDCADAAENLSVGRECVEGGVEDRGQVCRAAVKAG
QAVVDGSLLQTPSQRRPREPDDDSLDGLPRSACKRPKLDVSLDEWDLSGLPWWFLGNLRS
NCSRKSNGSTDIHTNQEEDTAIVSDTTDDLWFLTEGESEQVSVEMKEATLEEGSGGEGEA
CPEEDDGAGKEEKGNKEMQEEPDEDSQCLSDDTDIEISTQDAWQCTECRKFNTPLQRYCI
RCWALQKNWYKDVPRLAHSLSVPDIPACSSLAAHDDEDDSDGGVDVPDCPRTVSDPVILP
SHSTADRPLPAALTGKGKAPWSSSFRKDEAVSEGDSQESLGMEVEEVRPEALLEPCKLCR
VRPRNGNIIHGPTAHLLTCFPCARRLHKFHAPCPGCGKIIQKVIKIFIL
NT seq 1587 nt   +upstreamnt  +downstreamnt
attactatgagctctctatcagccgagcctccatcatcaagctcttcatgcaggacactt
ccaggagagggaaaccaggtacagccaaaagctcctctcctgcagattctacgtgttgca
ggagcccaggaagaggttttcacgttgaaagaggtaatgcactatttgggtcagtacatc
atgggaaagcaactgtatgataaacagaggcaacatatagttcactgccaggacgatccc
ctaggagaactgctggaggtggagagcttttctgtcaaaaacccaaggtattcaaccaca
accagaatggtcaacgcaacgaatgggagactgtgtttttttttactgtctgagaaaaat
aagagagtctattttaatgtgtgtattctgtttcacagcccggtgtatgaaatgctcaag
aagtacctagttgtgcttgactgtgctgacgctgcagagaatctttctgtgggccgtgaa
tgtgtagagggcggagtggaggatcgtggtcaggtgtgcagagctgcggtgaaagcgggg
caggctgtcgtcgacgggtctctcctgcagacgccctctcagaggcgaccgcgggagcca
gacgacgactctctcgacggcctgccgcgatccgcttgcaaacgacctaagctggacgtt
tctttggatgagtgggacctctcaggcctgccctggtggtttctgggtaacctccgcagt
aactgcagccgcaagagcaacggttccaccgacattcacacaaaccaggaggaggacacg
gctatcgtgtcggacaccaccgacgacctttggttcctgaccgaaggggagagcgaacag
gtaagcgtggagatgaaagaagccactctggaagaagggagcggcggtgaaggagaggcc
tgtcctgaggaggacgatggcgcagggaaggaggagaagggaaataaggagatgcaggag
gagcctgacgaagactcgcagtgtctcagcgatgacaccgacattgagatctccacgcag
gacgcgtggcagtgcacagagtgccggaagttcaacacgcctctgcagcgctactgcatc
cgctgctgggctctacagaagaactggtacaaagacgtccctcggctcgcccactccctc
tccgtccccgacatcccagcgtgctcctctctggccgcgcacgacgacgaagatgacagc
gacggcggcgtcgatgtccccgactgccccaggaccgtgtctgaccccgtgatcttgccc
tctcattccacagccgaccgcccgttgcccgccgcgctaacgggaaaaggcaaggctccg
tggtcttctagcttccgcaaagacgaggcggtctcggaaggggacagtcaggaaagcctg
ggcatggaagtggaagaggtccggcccgaggccctgctggagccctgcaagctgtgccgc
gtgcgcccgaggaacgggaatatcatccacggacccaccgctcacctgctaacctgcttt
ccctgcgcgaggaggctgcacaagttccacgctccttgtccgggatgtgggaagatcatt
cagaaagttattaagatattcatcctt

DBGET integrated database retrieval system