KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00014459G001
Entry
GSTEN00014459G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K10131  phorbol-12-myristate-13-acetate-induced protein 1
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
tng04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    GSTEN00014459G001
   04115 p53 signaling pathway
    GSTEN00014459G001
SSDB
Motif
Pfam: PMAIP1
Other DBs
NCBI-ProteinID: CAF97185
UniProt: Q4SQ97
LinkDB
Position
4
AA seq 44 aa
MAKKEIPAVAEVARELCRLGDALYWRYKLVEILTKNYTTVAKVK
NT seq 135 nt   +upstreamnt  +downstreamnt
atggcgaagaaggagatccccgccgtggcggaagtcgcgcgagagttgtgccggctcggg
gacgcgctttactggagatacaaactggtggagatcctgaccaagaactacaccaccgtg
gccaaggtcaagtga

DBGET integrated database retrieval system