KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00014575G001Help
Entry
GSTEN00014575G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00010  Glycolysis / Gluconeogenesis
tng00051  Fructose and mannose metabolism
tng00052  Galactose metabolism
tng00500  Starch and sucrose metabolism
tng00520  Amino sugar and nucleotide sugar metabolism
tng00524  Neomycin, kanamycin and gentamicin biosynthesis
tng01100  Metabolic pathways
tng01200  Carbon metabolism
tng04910  Insulin signaling pathway
Module
tng_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tng_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSTEN00014575G001
   00051 Fructose and mannose metabolism
    GSTEN00014575G001
   00052 Galactose metabolism
    GSTEN00014575G001
   00500 Starch and sucrose metabolism
    GSTEN00014575G001
   00520 Amino sugar and nucleotide sugar metabolism
    GSTEN00014575G001
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    GSTEN00014575G001
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    GSTEN00014575G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tng04131]
    GSTEN00014575G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     GSTEN00014575G001
Membrane trafficking [BR:tng04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    GSTEN00014575G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 ARID Mito_carr
Motif
Other DBs
NCBI-ProteinID: CAF97272
UniProt: Q4SQ10
LinkDB All DBs
Position
7
AA seq 1314 aa AA seqDB search
VFQLHSYLEPFRLSLEKLQEVSNRLRKDMIRGLKKHSHQNAPVKMLPTFVRATPDGTEKG
DFLALDLGGTNFRVLHVRVVEEEQKVLKMDSQICTIPKEMMLGPGEKLFDHIAACLSEFI
SSRNLKGQTLPLGFTFSFPCEQKEIDKSILIRWTKGFKCSGVEGEDVVRLLKEAIRRRGD
YEIGTVAMVNDTVGTMMSCGYRDQSCEIGLIIGTGTNACYMEEMKNVKRVEGEDGRMCIN
TEWGGFGDDGALKDIQTTFDVTVDETSVNPGVHIFEKMISGMYLGEIVRLLLVKLTEDQL
LFGGQASEALLTPETFETKFISQIEEEEHSLENARTILTRLGLDWDEVDARIVRVCCDTI
SSRSARLCAAALAAIADRIRTNRRMERLKTTVGVDGTVYKKHPNFSDELQATVRLLAPAC
DIRFLVSEDGSGKGAAMFGASGGNFCTSLQVRGCRWSERPAGGAVSPWSGAPSCQRGSYA
FYKSVSSRAQPDGPLQLWKLGEFYFIRCGPQDPVCIAEVTLLWEDRTQHHLLASTRLYFL
PEDTPKGRTREHGEVGAARLHTKIPTVKAERSRRSSGGVQEDGGDPVGANGVKVLSYPQY
CRFRSLQRRILERARAPGLQDPHLLALGGVRALPTTRLMYCRDTFSHPALENSAEFSWQL
RERDGQRGGRLRGRLAPSPRRAALPGPAVRLHGAAGLPHPQSPPPGLQKDRPLPHVFCRE
TPGRLQKGKAATSPPDLLVHFHPACRSSASRFLAGVYAEVHRKEALACWFCSSVSLGIMI
RTGTGGERQRLDFLSLRLPRAALCRIRLGGTISEQSVVFQSLGGKQQQVLVFLCVLLLSH
ILFPHQMSQRMQDSVEMVTILSFALQVTLDRLWKVVYNELGGCPGSTSAATCTRRHYERL
MLPYEEHLRAGAAEFKIPESPMPPKARGMKGGRKPLPRGRRPGAKAKEKRIGAPAASPSA
GALAKRGRGRPPGTRNKTTLMAEAKLLSQQEAPARAAAHGTPRPKPKEQKAEAVEPAASP
RSLILSAFPRHFVGGSLSGFSPTKGVCPLDVFRSRMSLQRTLESPALTPQDPPNGVQKGG
PREGRGRPPLPPLRVLPLNLDCSVQVNQLMRTRLGSAQFQTFTRCLSEALSHDLGAKPPC
APITPPPEQALPLNLSKRFAAKRPGAAEAPDPSLGPVLGNQEQPPSKRARVVGCPAQAED
LSQRTAPVSAGTGGAGQNLKNQEEPADLSSPSRIRAFLLGLPPFQVKFEEDLNGTRFGRL
LAPGSKAEPPRTQSQTAEGLVAVKPEQAEGADTEVKLQKQEEMEPLPSSLVQLS
NT seq 3945 nt NT seq  +upstreamnt  +downstreamnt
gtttttcagctgcacagctacctggagcccttccgtctgtcgctggaaaagctgcaggag
gtgtctaaccggctccggaaggacatgattcgaggtctgaagaaacactcccatcaaaac
gcgcccgtcaagatgctgcccaccttcgttcgagccacgcccgacgggacagagaagggc
gatttcctggctttggacctgggcgggacaaatttccgagtgcttcacgtgcgcgtggtg
gaggaggagcagaaggtgctgaagatggacagccagatctgcaccatcccaaaggaaatg
atgctggggcccggagagaagctcttcgaccacatcgcagcgtgtctgagcgagttcatc
agctccaggaacctgaagggccaaacgcttcctctgggcttcaccttctctttcccctgt
gagcagaaggaaattgacaagagtatcctgatccgctggacaaaaggcttcaaatgttct
ggagttgagggggaagacgtggtccggctgctgaaggaggccatccggaggagaggggac
tatgagatcggaacggttgccatggtgaacgacaccgtcggtacaatgatgagctgtggc
tacagggaccagagctgcgagatcgggctgatcatcggtacgggaacaaacgcctgctac
atggaggagatgaagaacgtgaagcgtgtggagggcgaggacgggcggatgtgtatcaac
accgagtggggtgggttcggggacgacggcgccctcaaagacatccagacgacgttcgac
gtgacggtggacgagacgtccgtcaatcccggcgtccacatcttcgagaagatgatcagc
ggcatgtacttgggagagatcgtccggctgcttctggtgaagctgacggaggaccagctg
ctgttcggcggtcaggcctccgaggcgctgctgacgccggagaccttcgagaccaagttc
atctcgcagatcgaggaggaggaacacagcttggaaaacgctcgaaccatcctgaccagg
ttgggcctggactgggacgaggtcgacgcccgcatcgtgcgggtgtgctgcgacaccatc
tcctcacgctccgcccgtctgtgcgccgccgccctggcagccatcgccgatcgcatccgc
accaacaggaggatggagcgcctgaagaccacggtgggcgtggacgggacggtctacaaa
aaacaccccaatttcagcgatgagctccaggccaccgtgcgcctcctcgcccccgcctgt
gacatccgcttcctggtctccgaggatggcagcgggaagggtgccgccatgtttggtgcc
tctggtgggaacttctgcacgtccctgcaggttcgtggctgcaggtggtccgagcggcca
gcaggtggcgctgtttccccgtggtcgggggctccctcctgccagcggggcagctacgcc
ttctacaagtctgtgagcagcagagctcagcccgacggacccctccagctgtggaagctc
ggcgagttctacttcatccgctgcgggccgcaggatccggtgtgcatcgccgaggtgacc
ctgctgtgggaggacaggacgcagcaccacctactggccagcactaggctctacttcctg
cccgaggacacgccgaagggccgcacccgggagcatggagaggtgggggccgctcggctg
cacacaaagatacccacggtgaaggcggagcgctcgcgacgaagttctggcggtgtgcag
gaagatggtggtgacccggtgggggccaatggcgtcaaagtgctcagctaccctcagtat
tgccgcttccgctccctgcagaggcgcatcctggagagagccagggccccggggctgcag
gacccccacctgctggccctgggcggcgtgcgagccctgcccaccacccggctgatgtac
tgcagggacacgttcagccacccggccctggagaacagcgcagagttctcctggcagctc
agagaacgtgatgggcagcgtggaggccggctgcgagggcggctggctccctcaccccga
agagcagctcttcctggaccagctgtacgccttcatggagcggcagggctcccccatcca
caaagtcccccacctgggcttcaaaaagatcgacctcttcctcatgtattctgtcgtgaa
acgcctgggaggctacagaaaggtaaagcagcgacctctcctcctgacctgttggttcat
ttccaccccgcctgccgtagctcagcctctcgcttcctcgctggcgtttatgcagaagtt
catagaaaggaggcgctcgcgtgctggttctgctcttcagtctcactcggaataatgatc
agaacaggaactggaggcgagcggcagcgtctcgatttcctcagcctgcgtctgcccaga
gcagccctctgcaggataaggctgggaggaacaattagtgaacaatcagtagtgtttcag
agtttgggaggcaaacagcagcaagtgttggtcttcctgtgtgttttgcttctgtcccac
atcctttttccccatcaaatgagccagcgcatgcaggactctgttgaaatggtcaccatc
ctgtcgttcgccctccaggtgacgctggaccgtctgtggaaggtggtttacaacgagctg
ggaggttgtcccggcagcaccagcgctgcgacctgcacgaggaggcactatgagcggttg
atgctcccgtacgaggagcacctcagagccggagcagcggaatttaaaatcccagaatcc
ccgatgccccctaaagccagagggatgaaaggagggcggaagccgcttcccagaggcagg
agaccgggagctaaagctaaggagaagaggatcggggctcctgcagcgtccccctccgct
ggggcgctggccaagcgaggccggggtcggccgcccggcacgcgcaacaagaccacgctg
atggccgaggccaagctgctgtcccagcaggaggcgccggccagagcggccgcccacggc
acacccaggccgaagcccaaggagcagaaagcggaggcggtggagcccgcggcgtcgccc
cgcagcttgatcctctccgccttccctcgccactttgtgggcgggtctttaagcggcttc
agccccaccaagggcgtctgtcctctggatgtcttcaggagccgcatgagcctccagagg
accctggagagcccggctctgacgccccaggacccccccaacggcgtccagaaaggtggc
ccccgggagggccgcggccggcccccgctgccccccctccgggtcctgcctctcaacctg
gactgcagcgtccaggtgaaccagctgatgcggactcggctcggctcggcccagttccag
accttcacccgctgcctgtcggaggctctgtctcacgacttgggcgccaagcccccctgc
gcccccatcacccctccccccgaacaggcgctaccgctcaacctcagcaaacgcttcgcg
gccaagaggcccggcgccgccgaggcccccgacccgagtctgggccccgtcctgggaaac
caggagcagcctccgtccaagagggcccgggtggtgggctgcccggcccaggccgaggac
ctcagccagcggaccgcgcccgtctccgcagggaccggaggagccggccagaacctgaag
aaccaggaggaaccggcggacctgagctcccccagcaggatcagggccttcctgctgggc
ctgccgcccttccaggtcaagttcgaggaggatctgaacgggacgcgcttcgggaggttg
ctggcaccgggatccaaagcggagcctccgaggacccagagccagacggcggagggacta
gttgcggtcaagccggagcaggcggagggagcggacacagaggtgaagctccagaagcag
gaggagatggagcctcttcccagctctctggtccagctgagctga

DBGET integrated database retrieval system