KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00014774G001Help
Entry
GSTEN00014774G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00511  Other glycan degradation
tng00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    GSTEN00014774G001
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    GSTEN00014774G001
Enzymes [BR:tng01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     GSTEN00014774G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR BNR_3
Motif
Other DBs
NCBI-ProteinID: CAF97418
UniProt: Q4SPL4
LinkDB All DBs
Position
16
AA seq 468 aa AA seqDB search
MMRSPYFPARTVLFHKEPSGVTYRVPALLYVSRSRCFLAFCEERLSPSDSQAHLLVMRKG
TFYRNYVEWGDMRVLSTAVLPGHRSMNPCPVYDQFTGTLFLFFIAILGHTSESYQLTTGK
NLSRLCFTCSTDDGETWSPVTDLTKKVIGDTIKGGSVTGVIPCSCAPLRPTICQVSPVLY
VLTPAPPARPEWATFALGPGHGIQLKSGRLLIPAYTYHIDCRQCFGQLCLTTPHAFCFHS
DNHGHTWRFGEAVPGPDSVECQVVSVDEEDGTNVLYCNARSPLGYRVQALSLDDGAVFQE
GQLVQRLVEPRNGCHGSIVGFPAPIHLLQHAKGAPRRRHWTSFLALNRPDSPARRSTVST
NHAVSPDFLTPTWVVYSHPTWSTSRMDLGVFLSPFPRDPDSWRGPWVIYEGPSAYSDLAH
LELPTSPGAAPAPAPAFACLFECGSKTAYDQICFCIFTLYELIDNLPQ
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgatgaggtcgccctacttccctgcgcggactgtgctcttccacaaggagcccagcggc
gtgacctacagggtccctgcgctgctctacgtgtcccgctccaggtgcttcctggccttc
tgcgaggagaggctgagcccgtcggactcccaggctcacctgctggtcatgaggaaaggc
accttctacaggaactacgttgagtggggcgacatgcgtgtcctgagtaccgccgttctg
ccgggtcaccggtccatgaacccgtgcccggtgtacgaccagttcacgggtactctgttc
ctgttcttcatcgccattctgggccacacctcggagtcctaccagctgaccacggggaag
aatctgtcccgcctttgcttcacctgcagcactgatgacggagagacctggagtccggta
acggacctcacaaagaaggtcataggtgacaccatcaaaggtgggtcagtcacaggggtc
attccgtgcagctgtgctcctctcagacccacaatttgtcaggtgtcccctgtcctctac
gtactaacgccggctcctcctgcccgtccagaatgggccaccttcgcgctgggcccgggc
cacggcatccagctcaagtccgggcgcctgctgatcccggcctacacctaccacatcgac
tgcaggcagtgtttcggccagctctgcctgaccacgccccacgccttctgcttccacagc
gacaaccacgggcacacctggcgcttcggggaggcggtgccggggccggacagcgtggag
tgccaggtggtgtctgtggacgaggaggacgggaccaatgtgttgtactgcaacgcccgc
agccctctgggctacagggtgcaggccctcagcctggacgacggagccgtctttcaggag
ggccagttggtgcagcgcctggtggagcccagaaacggttgtcatggcagcattgtggga
tttcccgccccgatacacctgctgcagcatgcaaagggggcgcctcgccgcagacactgg
acgtcgttcctggctctgaaccgccccgactctcccgcacgcaggagcaccgtttcgacc
aatcacgcggtctctccagacttcctcacccccacctgggtggtgtactctcacccaaca
tggagtacctcacgcatggacctgggagttttcctcagcccgtttccacgtgatccggac
agctggcggggcccctgggtgatctacgagggccccagcgcctactctgacctggcccac
ctggagttgccgacctcccccggggcggcgccggccccggccccggctttcgcctgcctg
tttgagtgcgggtcaaagacggcctacgaccaaatctgcttctgcatcttcaccctgtac
gaactgattgacaacctgccgcaa

DBGET integrated database retrieval system