KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00015370G001Help
Entry
GSTEN00015370G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:tng00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    GSTEN00015370G001
Enzymes [BR:tng01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     GSTEN00015370G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     GSTEN00015370G001
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    GSTEN00015370G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD
Motif
Other DBs
NCBI-ProteinID: CAF97873
UniProt: Q4SNA9
LinkDB All DBs
Position
8
AA seq 1257 aa AA seqDB search
MEVDGWDSSLEEELGVSLDELRKVIEATVETSDIVQEKRAQLMELKQLVEEKEKEEAQTE
LLLTRAFQSVEECEKLVKAACQRNGLVYQESGPEDQGEEGCPLSPEVIEIDDEDDDDDVI
AVGCCELYDFISVHPVKKESVDLSLRSFSGSTSKDGSSEQRPAGAEFSPVGEKAFGHRHR
SAASMPVSSAPAVFVSQVPSQSVTQPNPNVSEDELKTGMNILGKKRTKTWYRGILIAITP
IGNGVLKYKVKFDKGKNLLSGNHIAFDYNPTLEALYVGARVVAKYKDGNLVWLYAGIVAE
MPNNKNRMRFLIFFDDGYASYVTLPELFPVCRPLRRTWEDIEDPSCRDFIEEYITAYPSR
PMVLLKVGQIIKTEWEGTWWKSKVEEVDGSLVKILFLDDKRSEWIYRGSTRLEPMFNLKM
TTANMQEKKLAGQQRTRPNMGALRSKGPVVQYTSDGPVGASPVKSPPTSPSQPPQTSPQT
QHPPPSEPQQSAQAPQPAPLPRPEGKHQMAKKSTSPFVPGVGGTHASKISLSSGPSNPAA
VKTGNLLIAAAATASPTPPSYPKQQSAPAPPPVPPATAIVPQQPAYRASTDRIFYLPHTC
QPACLKRVRPVGPDVHQGKNPLLMPLLYEFRRMTGRRKVNRKMSFHVIYKAPCGLCLRNM
SEIQHYLFQTNCDFIYLEMFCLDAYVLVDRPFQPQRPFYYIHDITGGKEDIPLSCVNEID
STPPPKVAYSKERIPEDGVFINTSDDFLVGCDCTDGCRDKSKCSCHQLTRQATGCTPGGQ
INPNAGYTYKRLEECLPTGIYECNKRCKCCPRMCTNRLVQHGLQVRLQLFKTQNKGWGIR
CLDDIAKGSFVCIYAGKILTDDFADKEGPEMGDEYFANLDHIESVENFKEGYESEAHCSD
SEGSGVDVSKIKIQPSALVSSNPPGRPTKKAAQSSSSSQDTNDEDDKDSKSEEESDSSDD
TFVKDSYYSSSSVWRSYTTRGQVKGNKEGEDAAAPALRKKTSGVRALGVFLLSSLGSQDS
KDGMNTSTKGNDEDKPPAMPEESGKSKVVSWLNQGLKTETGESNSQVKAEAEKKQDVMTL
SDSDDVQTISSGSDDNKEKEKVPLGVTKKQVAVKSTRGIALKAGHGMMVKTGTPGGAGGP
GGSSKTGQQGHSGGGGDGAHRNTRLFFDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQN
VFVDTHDLRFPWVAFFASKRIRAGTELTWDYNYEVGSVQGKVLLCCCGSTECRGRLL
NT seq 3774 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggatggctgggactccagtctggaggaggagctgggtgtttctctggacgag
ctcagaaaggtcattgaagcaactgtggaaactagcgacattgtgcaggagaagagggct
cagttgatggagctcaagcagctggtggaggagaaagagaaagaggaggcccagacagag
ctgctgctgaccagagcctttcagtccgtagaggagtgtgagaaactggtgaaggcagct
tgccaaaggaacggcctcgtttaccaggagagcggcccggaggaccaaggggaggaagga
tgcccgctgtcccccgaggtcatcgagatagacgacgaggacgatgacgatgatgtcatc
gccgttggttgttgtgagttgtacgacttcatctctgtccacccagtgaaaaaggaatcc
gtggatttatctctccgttctttcagtggttccacctcaaaagatggcagttctgagcag
agacccgctggtgcagaatttagcccagttggtgaaaaagcattcggccatcgtcaccgc
agcgccgcctccatgcccgtcagttcagcgccggcggtgtttgtgtcccaggttccgtcc
cagtccgtaacacagccgaaccccaacgtgtcagaagacgagctcaagacggggatgaac
attttagggaaaaaacgcaccaagacctggtaccggggcatcctcatcgccatcacccct
attggaaacggcgtgctcaagtataaagtaaagtttgacaaaggcaaaaacctgttgtcg
ggaaaccacatcgctttcgactacaaccccaccctggaggctctgtacgtcggtgctcgg
gttgtggccaagtacaaagacggtaacctggtgtggctgtacgctggaatagtagcagag
atgcccaacaacaagaaccgaatgaggtttttaatcttctttgacgatggatacgcctca
tacgtaacgttacctgagctcttcccagtttgtcgaccattacggcgtacctgggaggac
atagaggacccgtcctgtcgagactttatcgaggagtacatcacggcctaccccagcagg
cccatggtgctcctgaaagtgggccagatcatcaagaccgagtgggaagggacgtggtgg
aagagcaaagtggaggaagtggatggaagcctggtcaagatcctctttctggacgataag
aggagtgagtggatctacagaggctccaccaggctggaacccatgttcaacctgaagatg
accaccgccaacatgcaggagaagaagctggccggccagcaaaggacgcgacctaacatg
ggagcgctgaggagcaaaggcccggttgtacagtacaccagcgacggccctgtgggagcc
tctcccgtcaaaagcccaccgacgtcgcccagccagcctccgcagacgtccccacaaacg
cagcatcctccgccctctgagccccagcagagcgcgcaggcgccccagcccgcgccgctg
ccacgtcccgagggtaaacaccaaatggccaagaagagtacttctccatttgtgcccggg
gtgggaggaacccacgcctccaaaatcagcctttcctctggtcccagtaaccccgccgcc
gtaaaaacaggaaacctcctgatcgcggctgcagccacggcctcccccaccccaccctcg
tacccgaaacagcagtccgcccccgccccgcctcccgttcccccggccaccgccatcgtc
ccgcagcagccggcgtaccgcgcctccacagaccgcatcttctacctgccccacacgtgc
cagccggcctgcctgaagcgcgtccgtcccgtcggaccagacgttcaccaggggaagaac
cccctcctcatgcccttactctacgagttcaggcgcatgacaggccgacgcaaagtcaac
cgcaagatgtccttccacgtcatctacaaggccccgtgtggactttgcctgcgcaacatg
tccgaaatccagcactacctcttccagacgaactgtgactttatatatttggagatgttt
tgtttggacgcgtacgtgctggtggaccggcccttccagcctcagaggcctttctactac
atccacgacatcaccggtggaaaggaggacatcccgctttcctgtgtgaacgagatcgat
tccacgccgccccctaaagtcgcctacagtaaagagcggattcctgaggacggcgtcttc
atcaacaccagcgacgacttcctggtcggctgcgactgcacggacggctgccgggacaag
tctaagtgctcctgtcaccagctgacccgccaggctacgggttgtaccccaggggggcag
attaacccgaacgctggatacacctacaagcggttagaggagtgcctccccacagggatc
tacgagtgcaacaagcggtgtaaatgctgccctcgcatgtgcaccaaccggctggtgcag
cacggcctgcaagtgcgcctgcagctcttcaaaacccagaacaaaggctggggcatccgc
tgcctggacgacatagccaaaggctccttcgtctgcatctacgcgggtaaaattttgaca
gacgactttgccgacaaggaaggtccggagatgggagacgagtactttgctaatctggac
cacatagagagtgtggagaacttcaaagagggctacgagagcgaggctcactgttcggac
agcgagggaagcggcgtggacgtgtccaagatcaagatccagccgtccgctttggtgtcc
tccaaccctccaggacggcccaccaagaaggcagctcagagctcgagctcctcccaggac
accaacgacgaggacgacaaagactcgaaaagcgaagaggagagcgacagttccgacgac
accttcgtcaaggacagctactacagctccagctcggtgtggaggagttacaccacccgc
ggtcaggtcaaaggcaacaaggagggtgaggatgctgctgcgcccgctcttaggaaaaag
acgagtggagttagagcgttgggggtgtttttgttgtcttctttaggaagccaagacagt
aaagatgggatgaacacctccactaaggggaacgacgaggacaagccgccggccatgccg
gaagaatcggggaaaagtaaagtggtttcttggctcaaccagggcctgaagacggaaaca
ggagagagcaacagtcaagtgaaggcagaagcagagaagaagcaagacgtgatgactctt
tccgacagcgatgacgttcagaccatcagctcgggatcggacgacaacaaggagaaagag
aaagtccccctgggcgtgactaagaagcaggtggcggtgaagtccacccgaggcatcgcc
ctgaaggccggccacgggatgatggtgaaaaccggcacgcccggcggcgcaggaggtccc
ggcggcagcagcaagacgggacagcagggacactcgggaggaggcggagacggcgctcac
agaaacactcgcctcttcttcgacggcgaggagtcctgttacatcattgacgctaagctg
gaaggaaatctggggcgctacctcaaccacagctgcagtccgaacctgtttgtccagaac
gtgtttgtggacacgcatgacctgcgctttccctgggtggcgttctttgccagcaagcgg
attcgggccggcacggagctgacgtgggactacaactacgaggtgggcagcgtgcagggg
aaggtgctgctctgctgctgcggctccaccgagtgcagagggagactcctgtga

DBGET integrated database retrieval system