KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00015697G001Help
Entry
GSTEN00015697G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00052  Galactose metabolism
tng00500  Starch and sucrose metabolism
tng01100  Metabolic pathways
tng04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    GSTEN00015697G001
   00500 Starch and sucrose metabolism
    GSTEN00015697G001
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    GSTEN00015697G001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tng04147]
    GSTEN00015697G001
Enzymes [BR:tng01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     GSTEN00015697G001
Exosome [BR:tng04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GSTEN00015697G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-ProteinID: CAF98114
UniProt: Q4SML8
LinkDB All DBs
Position
18
AA seq 853 aa AA seqDB search
PAAPPLGDTCGSIPESWRFDCYPERGVIVTRELCEARNCCFIPASSSSSSSRPPPSGGNG
VPWCFYPADFPSYRLVSINDTSLGQKGTLVKEVRTYYPADILTLEVDLRHETDTRLHVKI
TDPSNPRFEVPISVPAATKKAESPDYLVEVSRQPFGLVVRRRSSGVVLLNTTVAPLFYAD
QFLQMSTSLPSPFVYGLAEHRSSFLQEVRWNTLSLWARDVPPMEQANLYGAHPFYLLMED
GGAAHGFFLLNSNAMDVSLQPAPALTWRTIGGILDFYLFLGPDPASVVGQYLEVVGRPAM
PVYWALGYHLCRWGYGGTNATWETVRHLRNYGIPQVRFRPPSLGSVGSGKLKGWLVCGQD
VQWNDIDYMDRKLDFTLDSNFSSLPDMIADLHAHHQRYVLILDPGISSTQPEGSYWPYED
GMKRDVFIRDWEGNVILGKVWPGLTAYPDFSNAETHEWWYDSLKRFHQKVPFDGLWIVST
DAGGKKPLQKKDMNEPSNFLEGSTKGCPSTSLENPPYTPGILGGSLKSKTLCASAQQKLS
SHYNLHNLYGLMEAQATASALKRIVPKRPFVLSRSTFPGQGMYSGHWLGDNKSRWKDMYT
SIAGMLTFNLLGIPLVGADICGFQEDTQEELCVRWTQLGAFYPFTRNHNDLSSKAQDPTV
FSPLARTAMRDALLLRYSLFPLLYTLFHHAHVKGHTVARPLMFEFPKDVRTYGIDRQFLW
GRSLLVTPVLDPGVDHVVGYFPEGLWYDYYTGDSIRSKGEEVNLHAPLDKLNLHLREGSV
TPTQNTMTSTVLHSNVEASYITVETASFYGVKQRPSRVLVNSQEAVFSYRDNQVMTVADL
GLKLSQNFTISWV
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
cccgccgctcctcccctgggggacacgtgcggttccatcccagagagctggaggttcgac
tgttacccggaaagaggggtgatcgtgacccgggagttgtgcgaggccaggaactgctgc
ttcatccctgcgtcctccagctcctcctcctccaggccgcctccctcgggaggaaacggc
gtcccgtggtgcttctacccggcagatttcccctcctacaggctggtgtccatcaacgac
acctccctcggacagaagggcacgctggtgaaggaggtgaggacctactaccccgcggac
atcctcaccctggaggtggacctacgtcacgagacggacacgcggctccacgtcaagatc
accgacccctccaatccccgctttgaagtccccatctccgttcccgccgccaccaaaaag
gcagaaagtccagactacctggtggaggtgtccaggcagccgtttggcttggtggtcagg
aggaggtcctccggggtggttctcctgaacaccacggtggctcctctcttctacgccgat
cagttcctgcagatgtccacctccctgcccagccccttcgtctacggcctggccgagcac
cgctcctccttcctgcaggaggtccgctggaacaccctcagcctgtgggccagagacgtc
cctcctatggagcaggcaaacctttacggcgcccaccctttttacctgctcatggaggac
ggcggcgccgcgcacggcttctttctgctgaacagcaacgccatggacgtcagcctccag
ccggctccggccctcacctggcgcaccatcggcggaatcctggacttctacctgttcctg
ggccccgatccggcctcggtggtgggccagtacctggaggtcgtaggccgcccggcgatg
cccgtctactgggcgctgggctaccacctgtgccggtggggctacggggggaccaacgcc
acctgggagactgtcaggcatttgaggaattatgggataccgcaggtaaggttccggccg
ccgtccctcggctccgttggctctgggaagctgaaggggtggctggtctgtggacaggac
gtccagtggaacgacattgattacatggaccggaagctggacttcactttggacagcaac
ttctccagcctgcctgacatgatcgccgacctgcacgctcaccaccagagatacgtcctg
atcctggacccgggcatcagcagcacgcagcccgagggctcgtactggccgtacgaggac
gggatgaagagggacgtgtttatcagagactgggaggggaacgtcatcctggggaaggtg
tggcccggcctgaccgcgtatcccgacttctccaacgcggagacgcacgagtggtggtac
gacagcctgaagaggttccaccagaaggtgcccttcgacgggctgtggattgtaagtacg
gacgcgggcggaaaaaagcctcttcagaagaaagacatgaacgagccgtccaacttcctg
gaaggcagcaccaaaggctgcccgtccaccagcctggaaaatcctccttacactcctggc
atcctcggaggctccctgaaatccaaaaccctgtgtgccagcgcgcagcagaaactgtcc
tcgcactacaacctgcacaacctgtacggcctgatggaagctcaggccaccgccagcgct
ctgaagcggatcgtccccaagagaccctttgtcctgtcccgctccaccttccccggtcag
ggcatgtactccggccactggctgggagacaacaagagccgctggaaagacatgtacact
tccatagcagggatgctgacctttaacctcttggggatcccgctggtgggagcagatatc
tgtggcttccaggaggatacgcaggaggagctgtgtgtccgctggacgcagctgggcgcc
ttctatcccttcacgcgcaaccacaacgacctcagcagcaaggcccaggacccgaccgtt
ttcagccctctggctcgcaccgccatgagggacgccctcctgctgcgttactctctcttt
cctctcctctacacgctcttccatcacgcacacgtgaagggccacaccgttgcgcggccc
ctgatgttcgagttcccgaaggatgtgcgaacgtacgggattgacaggcagttcctgtgg
gggcggagtctactggtgaccccggtgctggaccctggggtggaccacgtggtgggctac
ttcccggaggggctgtggtacgactactacacgggagactccatccgcagtaaaggtgaa
gaggtcaacctccacgcccctctagacaagctcaacctgcacctacgtgaaggttcggtc
acaccaacgcagaacacgatgacgtcgacggtgctccacagcaacgttgaggcctcgtac
atcaccgtggaaacggcctccttctatggcgtcaagcagagacccagcagagtcctggtc
aactcccaggaggccgttttctcctacagagataaccaggtgatgacggtggccgacctc
ggcctcaaactcagtcagaacttcaccatcagctgggtgtga

DBGET integrated database retrieval system