KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00016608G001Help
Entry
GSTEN00016608G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00010  Glycolysis / Gluconeogenesis
tng00030  Pentose phosphate pathway
tng00051  Fructose and mannose metabolism
tng00052  Galactose metabolism
tng01100  Metabolic pathways
tng01200  Carbon metabolism
tng01230  Biosynthesis of amino acids
tng03018  RNA degradation
Module
tng_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSTEN00016608G001
   00030 Pentose phosphate pathway
    GSTEN00016608G001
   00051 Fructose and mannose metabolism
    GSTEN00016608G001
   00052 Galactose metabolism
    GSTEN00016608G001
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    GSTEN00016608G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tng01009]
    GSTEN00016608G001
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tng03019]
    GSTEN00016608G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GSTEN00016608G001
Protein phosphatases and associated proteins [BR:tng01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GSTEN00016608G001
Messenger RNA biogenesis [BR:tng03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GSTEN00016608G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: CAF98776
UniProt: Q4SKQ6
LinkDB All DBs
Position
undetermined
AA seq 839 aa AA seqDB search
MVDGGDNIREATWESVSSMLQVGGTVIGSARCKEFRTHEGRLKAAHNLVQRGITNLCVIG
GDGSLTGANLFREEWSGLLTELVEQGLIEQDSIQKYSALHIVGMVGSIDNDFCGTDMTIG
TDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEMPPED
GWEDKMCQKLSATRSRGTRLNIIIVAEGAIDRHGKPITSSFVKDFRSCLATMLLKAQNRA
GKKRLNVIIVAEGAIDRSNTPITTDYIKDVSTELCVRVWRFPHLGCLLCDLYHCTAALLV
VKNLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVLALLETTANTPACVVSLCGNQS
VRLPLMECVEMTQEVQKAMDEKRFEEAVKLRGRSFENNLKTYKLLAHRKPESDLPHSNFN
VAVLNVGAPAAGMNAAVRSAVRVGISEGHKMFAVSDGFEGFYKGQIKEIKWADVGGWTGQ
GGSLLGTKRTLPAKHVDKIAAQMRQHNINALLIIGGFEGFLSLLELLTARGKYEELCVPM
VMVPATVSNNVPGSDLSIGADTALNAITSAFESLLQLFEARATYEEFCIPMCMVPATISN
NVPGTNLSIGADTALNAIVETCDRIKQSASGTKRRVFIIETMGGYCGYLASVGGLAAGAD
AAYIYEESFDIRDLQANVEHLTEKMKTSIQRGLVLRNENSNENYTTDFIYQLYSEEGRGV
FDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAMQWVTRKLGETFRQGRVFANSEDSCCLL
GMRRRALVFQPVVQLKDETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHV
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atggtggatggtggagacaacatcagagaagccacgtgggaaagtgtctccagcatgctg
caagtgggtggaaccgttatcggcagtgcgcgctgtaaagagtttcgcacccacgagggc
cgtctgaaggcagctcacaacctggtgcagcgcggcatcaccaatctgtgcgtgattggt
ggagacggcagcctgaccggagccaacctcttcagggaggagtggagcgggctgctgacc
gagctggtggagcaaggcctaatcgaacaggactccattcagaaatactcggccctccac
atcgtgggcatggtcggctccatcgataacgacttctgcgggaccgacatgaccatcggg
acggactcggccctgcacagaatcatcgaggtggtggacgccatcatgacgaccgcgcag
agtcaccagcgaaccttcgtgttggaggtgatgggcaggcattgtggctacctggccctg
gtgagtgccctggcctgtggagccgactgggtgctgattccagaaatgcctccagaggac
ggctgggaggataaaatgtgtcaaaagctctctgcgacccgctccaggggcacgaggctg
aacataatcatagtagcagagggagccattgacaggcacgggaagcctataacgtctagt
tttgtcaaggatttccgcagctgtctggccaccatgcttctgaaagcccagaaccgagca
gggaagaaaaggctgaatgtcattattgtagccgaaggggcgatcgatcgtagcaacacg
cccattaccactgactatatcaaggatgtaagtacagagctttgcgtcagagtctggcga
tttccccacctcggctgcctcctgtgtgacctctaccactgtactgctgccctgcttgtt
gtcaaaaacttgggttttgacacacgagtgaccattctgggacacgtgcagaggggagga
actccgtctgctttcgaccgcattctggccagccgaatgggcgtggaggctgttcttgcc
ctcctggagaccacagccaatacgcccgcctgtgttgtctcactgtgtggtaatcaatcg
gtgcgactgcctctgatggagtgtgtagagatgactcaagaggttcagaaagccatggac
gagaaacggttcgaggaggcagtgaagcttcgcggaaggagttttgaaaacaacctgaag
acctacaagcttctggctcatcggaaaccagagtctgaccttcctcacagcaacttcaat
gtggcggtgctgaatgtgggcgctcctgcagcgggcatgaacgcggccgtgcgttcagct
gtcagggtgggcatctctgaggggcacaagatgtttgctgtcagtgatggctttgaagga
ttctacaaaggacagataaaggagattaaatgggctgatgtgggcggatggacaggacag
ggtggatctctactggggaccaaaaggacacttcctgcaaagcatgttgacaagattgct
gcgcagatgcgacagcacaacattaatgctctgctcatcattggtggatttgagggcttc
ctctcacttctggaattgttaacggcacgtgggaaatatgaagagttgtgtgtccccatg
gtcatggtcccggccactgtctccaacaatgttccaggctcagacctcagcatcggcgct
gacacggctctgaacgccatcaccagcgcgtttgagagtctgctgcagctgtttgaggct
cgtgctacctatgaggagttttgcatacccatgtgtatggtgcccgccaccataagtaac
aatgtacccggcaccaacctgagtattggggcagacaccgccctcaatgctatcgtggag
acttgtgatcgcatcaagcagtcggccagtggaaccaagaggcgtgtgttcatcattgag
actatgggcggttactgtggatacctggccagtgtgggaggactggctgcaggcgccgac
gccgcctacatctatgaggagtcgtttgacatcagagacctgcaggccaatgttgaacac
ttgactgagaaaatgaagaccagcattcaaagaggacttgtgctcaggaacgagaactcg
aatgaaaactacacgactgactttatctaccagctgtattctgaggagggtagaggagtg
tttgactgcaggaagaatgtgctggggcacatgcagcaggggggagccccatctccgttt
gaccggaactttggcaccaagatctccgccaaggccatgcagtgggtgaccagaaagctg
ggggagaccttcagacaagggcgagtgtttgcaaacagcgaggactcctgctgcctgctg
ggaatgcgtcgcagggctctggtcttccaacctgtcgttcaactcaaggatgagaccgac
tttgttcacaggatccctaaagagcagtggtggctgaagctgcgccctctgatgaagatc
ctggccaagtacaaaaccagttacgacgtgtcggattctgggcagctggagcacgtg

DBGET integrated database retrieval system