KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00017026G001
Entry
GSTEN00017026G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K18496  fibroblast growth factor 1
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04010  MAPK signaling pathway
tng04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    GSTEN00017026G001
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    GSTEN00017026G001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tng04052]
    GSTEN00017026G001
   00536 Glycosaminoglycan binding proteins [BR:tng00536]
    GSTEN00017026G001
Cytokines and growth factors [BR:tng04052]
 Growth factors
  Growth factors (RTK binding)
   GSTEN00017026G001
Glycosaminoglycan binding proteins [BR:tng00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   GSTEN00017026G001
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-ProteinID: CAF99073
UniProt: Q4SJV9
LinkDB
Position
1
AA seq 141 aa
MADEGAAGGAFPRDYRRLARLYCMNGGHHLQILPDGTVRGLRDDGDAHTILKLKAVERGV
VVIRGTEAGRYLAMDDQGQLYGSPTVTDECYFLEQLEENHYNTYLSRSHRDRGWFVGLKK
SGQPKLGPRTHRGQKAVFFLP
NT seq 423 nt   +upstreamnt  +downstreamnt
atggcggatgagggcgcggcgggcggcgctttcccccgagactaccggcgcctggcgcgg
ctgtactgcatgaacggcgggcaccacctccagatcctgccggacgggacggtgcggggc
ctgcgggacgacggggacgcgcacaccattttaaagctgaaagcggtggagaggggcgtg
gtggtgatcagaggcaccgaggccgggcggtacttggccatggacgaccagggacagctg
tacggctcgcccaccgtgacggacgagtgttacttcctggagcagctggaggagaaccac
tacaacacctacctgtcccgcagccaccgggacaggggctggttcgtcggcctgaaaaag
agcggccagcccaagctgggccccaggacccacaggggccagaaggccgtcttcttcttg
ccc

DBGET integrated database retrieval system