KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00017027G001
Entry
GSTEN00017027G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K05771  glucocorticoid receptor
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    GSTEN00017027G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tng03000]
    GSTEN00017027G001
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:tng03310]
    GSTEN00017027G001
Transcription factors [BR:tng03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    GSTEN00017027G001
Nuclear receptors [BR:tng03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   GSTEN00017027G001
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-ProteinID: CAF99074
UniProt: Q4SJV8
LinkDB
Position
1
AA seq 923 aa
MDKGGVKKVTYRKDDLLSKLVYTESPEEGGLLKVAPHGAMSLTSATSVALPPSQLMQPGQ
ASNGLSSSPLPEERTSLAANVGQLLENPEIKGLTKDQKLQEQQLCLLHTTASLGGQILRD
SLQLEASTIDGTQSSMDTLIGGSDPNFFPMKTDDFSMDKRDQDPIDIDPSFEAIEKDGDV
HQKLFGDNTLDLLQDFELIGSPSDFYVGDDALLYSLADDSLLGDVSSEKDLKPAVVDSVI
GSGALSALNGNDTSPDQSSISTTATSLSSSPSLSVVVKKEKDADFLQLCTPGAIKEEKSS
PGQSYCQVQSATSAPEMLGSIVSICGVSTSGGQSYHFGVGPSSGEARQQKHPKPVSNQYL
PVTNLSGAWSREGESSAVHKAPEALARSSPYPICFTSFSTLKRLLLLSGPWLVPANISPT
LARAVLPSSRSPEISRYLAAVIPAVHAVCEWERFYHRVLPADRRVSSLRPPHRERAGGKS
AWFAPTRPRGATMESSPVAAARCSSKEPWKVRAWVSASSWSHVLVGFQSRHPALKDCVVY
HVDEGKGINGSPLCASGQHNYLCAGRNDCIIDKIRRKNCPACRFRKCLMAGMNLEGGPRL
LTNGSGEGLAARLLLRCTETPQSHLIFALSVSAARKTKKMNRLKGVQQSSPAKPAAPSPP
AEARSLVPKCMPQLVPTMLSLLKAIEPETIYAGYDSSVPDTSTRLMTTLNRVGGRQVISA
VKWAKALPGFRNLHLDDQMTLLQCSWLFLMSFNLGWRSCQQCNGNMLCFAPDLVINEERM
NLPYMADQCKQMLKISSEFVRLQVSHDEYLCMKVLLLLSTVPKDGLKSQAVFDDIRMSYI
KELGKAIVKREQNSSQNWQRFYQLTKLLDSMHEMVGGLLNFCFYTFVNKSLSVEFPEMLA
EIISNQLPKFKAGSVKPLLFHQR
NT seq 2769 nt   +upstreamnt  +downstreamnt
atggacaaaggcggagtaaagaaagtaacatacaggaaagatgaccttttaagcaagctg
gtctacactgaaagccctgaggagggaggtctgctgaaggtggctccccacggtgccatg
tccctcacatccgccacgtctgtcgctcttccaccgagccagttgatgcagccgggacaa
gcgtccaacggcctcagtagcagtccccttccagaagagcgcacctctttggctgccaat
gtgggccagttgttggaaaacccagagatcaagggtctgaccaaagatcagaaacttcag
gagcagcagctgtgtctcctccacactaccgcttccctaggagggcagattctacgggac
agtttgcagctggaggccagtaccatagatggtacgcagtcctccatggatacactgatt
gggggctcagatcccaacttctttccgatgaaaactgatgatttctccatggataaaaga
gaccaggatcccattgacatcgatccgtcctttgaggccattgaaaaagatggagatgtg
caccagaaactgtttggtgacaacaccctggatctgctccaagactttgagctcattggc
tcgccctctgatttttatgtgggagatgatgctctgctgtactccctggcagacgattct
cttctcggggacgttagctcagagaaggacctcaagcccgctgttgtcgacagcgtcatt
ggcagtggagctctctctgccttgaacggcaatgataccagtccagaccagtccagcata
tctactactgccacctccctttcttcttcgccttctttgtctgtggtagtgaagaaggaa
aaagatgctgactttcttcagctgtgcaccccaggtgcgatcaaggaggagaaatcctcg
ccaggccagagttactgccaagtccagagcgctacatctgccccggagatgctcggctct
atcgtctccatctgcggggtcagcacctctggaggacagagctaccactttggagtcggt
cccagcagcggcgaagctcggcagcagaagcaccccaagccggtgtccaaccagtatctg
cccgtcacaaacctcagcggggcctggagcagagaaggcgagagctccgccgtccacaag
gcccctgaggctctggccaggtcctctccctacccaatctgcttcaccagcttctctacg
ctaaagcggctacttctgctttctggcccctggctggtccctgcaaacatcagcccgact
ttggctcgtgcagttcttccgtcatccagaagtcctgagataagccgttatctcgcggct
gtgatcccagctgtgcacgctgtgtgtgagtgggagaggttttatcacagagttctgcca
gcagacaggagggtgtcatcgctacgtccaccgcacagggaaagagcggggggaaaatct
gcgtggtttgctccgacgaggcctcggggtgccactatggagtcctcacctgtggcagct
gcaaggtgttcttcaaaagagccgtggaaggtacgagcgtgggtgagcgccagcagctgg
agccacgttctcgtaggctttcagagccgccatccagcattgaaggattgtgttgtttac
cacgttgatgaaggtaaaggtattaatgggtctcctctgtgtgcctcaggacaacataat
tacttgtgcgctgggagaaacgactgcataatagacaagatcaggaggaagaactgccca
gcctgccgcttccgcaagtgtctgatggcaggcatgaacctggaaggtggtccccgcctc
ctgaccaatgggtctggggagggtttagcagcccgtctcctcctccgctgcaccgaaacc
ccccaatcccacctgatttttgctctgtctgtttctgcagcgcgtaaaactaagaagatg
aaccgtctgaagggggtccagcagagcagcccagccaagccggccgccccgagccccccc
gccgaggcgcgctcgctcgtgcccaagtgcatgccgcagctggtccccaccatgttgtcc
ctgctgaaggccatcgagccggagaccatttacgccggctacgacagcagcgtgccggac
acgtccacccgcctcatgaccaccctcaacagggtgggggggcgccaggtcatttctgct
gtcaaatgggccaaagccctgccaggcttcaggaacctgcacctggatgatcagatgacc
ctgctgcagtgctcctggctcttcctcatgtccttcaacctgggctggaggtcctgccag
cagtgcaacggcaacatgctctgcttcgcaccggacctggtgataaacgaggagcggatg
aacctgccctacatggccgaccagtgcaagcagatgctgaagatttccagcgagtttgtc
cggctgcaggtctcccacgacgagtacctgtgcatgaaggtgctgctgctgctcagcaca
gtgccaaaagacggcttgaagagccaggcggtgtttgacgacatccgcatgtcctacatc
aaggagctggggaaagccatcgtgaagcgcgagcagaactccagccagaactggcagcgc
ttctaccagctgaccaagctgctggactccatgcacgagatggttggcgggctcctcaac
ttctgcttctacacctttgtgaataagtccctgagcgtggagttcccagagatgttggca
gagatcatcagcaaccagctaccaaaattcaaggccgggagcgtcaagcccctcctcttc
caccagaga

DBGET integrated database retrieval system