KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00017177G001Help
Entry
GSTEN00017177G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K09293  paired box protein 8
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tng03000]
    GSTEN00017177G001
Transcription factors [BR:tng03000]
 Eukaryotic Type
  Helix-turn-helix
   Paired box domain only
    GSTEN00017177G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAX Pax2_C HTH_23 HTH_32 HTH_Tnp_IS1 HTH_28
Motif
Other DBs
NCBI-ProteinID: CAF99186
UniProt: Q4SJJ6
LinkDB All DBs
Position
4
AA seq 384 aa AA seqDB search
GGLNQLGGMFVNGRPLPEVIRQRIVDMAHQGVRPCDISRQLRVSHGCVSKILGRYYETGS
IKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLAEGVCDSDMVPSVSSINR
IIRTKVQQPFNLPLDGKGLSPGQTLIPSSAVTPPESPQSDSLAPPTPSAACWESLNPPAR
ARGATTTTLYSCRSSTGAWTTPRAARQQPLRHREESGTPGYAMVTEPLPLCLKQEMSPDV
ASASPSPNVAPNLAFVELQKPVSASSNGCSSSNHFPSHYNSFSHHAPVYGQFSSQPIMEG
HGELHLPGYPPHIPSPAQTGYSSSAITGMVAAGADYSGQTYSHSPYTSYSEAWRFTNSSI
LSSPYYYSTASRTAPPPAAAYDHL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gggggtcttaaccaactaggtggaatgtttgttaatggacgcccgcttccggaggtgatc
cggcaacgcatcgtggacatggctcaccagggcgtccggccctgcgacatctccaggcag
ctccgggtcagccacggctgcgtcagcaagatcctgggacggtactacgagacgggcagc
atcaaacccggcgtcatcggcggctccaaacccaaggtggccaccccgaaggttgtggac
aagatcgctgagtacaagaggcagaatcccaccatgttcgcctgggagatcagggacagg
ctgctggctgagggggtgtgtgacagcgacatggtgcccagcgtcagctccattaacaga
atcattcgaactaaagtccagcagcccttcaatctgcctttggatggaaaaggcctgagt
ccaggacaaaccctgattcccagttcagcggtcacccctcccgagtcccctcagtccgac
tctctggctccgcctactccatcagcggcttgttgggaatccctcaacccaccggcgagg
gcaagaggagccacgacgacaactctgtactcctgtcgctcatcaacgggagcctggacg
acgccaagagcagcccgtcagcagccactccgccatcgggaggaatctggcacaccaggg
tacgccatggtgaccgagcccctgccgctctgcctgaaacaggaaatgtcccccgacgtg
gccagcgccagcccctctccaaacgtggcccctaatcttgcgtttgtggagctgcagaag
cccgtttctgccagcagcaacggctgcagcagctccaaccacttccccagtcattacaac
tcattctcccatcatgcacctgtgtacggccagttcagcagccagcctatcatggaggga
catggtgagctccacctgccgggctaccctcctcacatcccctcgccggcacagacggga
tactcctcgtccgccatcacgggcatggttgcagcaggcgcagattactcgggtcagacc
tacagccattcgccctacacctcctacagcgaggcctggagattcaccaactccagcatc
ctgagttcaccatattactacagcacggcctcccgcacagccccgccgcctgcagcagcc
tacgaccacctc

DBGET integrated database retrieval system