KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00017296G001Help
Entry
GSTEN00017296G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    GSTEN00017296G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tng03036]
    GSTEN00017296G001
Enzymes [BR:tng01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     GSTEN00017296G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     GSTEN00017296G001
   HMT complexes
    COMPASS/SET1 complex
     GSTEN00017296G001
    COMPASS/SET1 complex (yeast)
     GSTEN00017296G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 Mem_trans
Motif
Other DBs
NCBI-ProteinID: CAF99275
UniProt: Q4SJA7
LinkDB All DBs
Position
4
AA seq 1830 aa AA seqDB search
MSKPGERNRLNEDHGRKQSSSLANGMDSHPVCGSAEKRSHHWRSYKLIIDPALKKGSHKL
YRYDGQTFSMPNPGIPPVEMVRDPRIGRLWTKYKETDLPVPKFKIDECYIGPVPPKEVTF
ARLNDNIREGFLTDMCKKYGEIEEVEILYNPKNKKHLGIAKVVFENVKAAKVAVQSLHET
SVMGNIIHVELDPKGENRLRYFQLLMNGSYTPRTLPVGGESPRSLAEALLVSTESLVIRV
LLSESSVTAAGGGVPPSSSTTPASLETGYSSLRQETPQSQGTPHTPRQAGTPFSQDSNYS
SRQSTPAYQSGRPESSGGYKSRRHESKFQDAYNRRPERPQYRSNMYRSSTSEQAPFKQHQ
LTPPEPPPSTPSFTYTAPPSATPNLKSTFSPYQAPLPPAFPPSEPVFHHPTQREDDYPRP
PQPPQAAAPEYLPTKDRPETPPIPEPPPPEPAPHPNTPPPQTPEQCPSPGSPTHEPERNS
LDSRIEMLFKEKRTKLLPFLEERDSDTEVRMEGSPISSSSSQLSPIPPFTGGSQGGLQNS
RPSSTGLEDISPTPLPDSEDEEPIRGTASLLKRVSSPVQDKVSNSERGTTPTDKTDTGQQ
SSGEDMEISDDEMPGTPIASGECAKGIVVNSAVSPMQTMSLPPPGFPSLSHQPSFPMPHH
HLTPHSAVPGHPAHLAGVPHHMLPHMDPYVHSMMPLMQMELMNCLRWEQWSTVPMSFQMQ
QQMLSRMAQTRGPYPYPHFMDGGASGPFGAHYPPLSMSAAPGGTTGMPGHQWQHPSLPTF
NPNVPPPGYDAKKEDPHKATVDGVLLVIVKELKAIMKRDLNRKMVEVVAFRAFDDWWDKK
ERSAKVSQSLLHKARSTESKEEERPKPKETMGSSLLENWNKGEGLGYEGMGLGIGLRGAI
RLPSFKVRLCVFPKKEPFSAARCLTVERCVQVKRKGPPEAASAGDNKRARPSTPVDDELE
DEDRDRDAAELPSDGSKMDGDGASSKRRHSRPLELDSEGEENDTSGKEEELLSDREEEPE
ETEAPERLLSGKESGEEERDDEEEADSSSERSSDSSDDEAESSSYSKASSDSSSASSDSS
EYEMNSEDEEEEEEEEEEDAKASAALDKESRSKTLQSSSSSSSSSSSSSSTSSSSSSSSS
DEEDREIRMEAPSSPVGLALKEKEGQRSKEELSSKVKRRPPSPEEELPLERRPPSPKPTP
GTLPNSTQEVKAKGKTEPGEALFTPGRLAPSQLDSKSGMHLPLPPHPEIEGRSLLHPPPG
PLPDLPQRPRLPTDEDIPRTPGRDLMERARSLGKSQSTDTVPITPGGDAPLTGSSSLLLS
SPHIPSSPFSYPAQSPVLSAGVPRTPGRDLTFTPVFPDPAALTLHRKVSSESLDDRPVFK
EPALSALPNQTLAAGTELSARVPEDLPSGLNVDVPVPSDTGSLKKKARRPKGKKASALST
SDESLELSSESAPPPRDGHLATLTTQRITAQSPKHSSLDFRDGELERQTVLPDEDGFLSY
EDEAPALIKPTRRQRRGWEELLLDSLSPVSSPQRSYFKPRSEFEEMTILYDIWNEGIDEE
DVRLLQITYEKMLQQDNGNDWLNDTLWVNHPYILYCSRKRRDDGMRDHATGCARSEGYYK
IDKKDKIKYLQSTRLQSEEPPVDTQGMSIPAQVHASTRAGSERRSEQRRLLSSFACDSDL
LKFNQLKFRKKKIRFCKSHIHDWGLFALEPIAADEMVIEYVGQNIRQVIADMREKRYEEE
GIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSRQPINVN
EEITYDYKFPIEDVKIPCLCGAENCRGTLN
NT seq 5493 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagccgggcgagaggaatagactgaacgaagaccatggcagaaagcagagttca
agtctggccaacggcatggacagtcatcccgtctgcggctcggcggagaagcggagccac
cactggagaagttacaagttgatcatcgacccggcgctgaagaagggatcccacaaactg
taccgctacgacgggcagactttcagcatgcccaacccggggataccgccggtggagatg
gttcgggacccaaggatcggtcgcctctggactaagtacaaggagacggatctgccggtg
cccaagttcaagatcgacgagtgctacatcggccccgtgcccccgaaggaggtgacgttc
gcgcggctgaacgacaacatcagggaaggatttcttaccgacatgtgcaaaaaatacgga
gaaatcgaggaggtggagattttgtacaacccgaagaacaaaaagcacttggggattgcc
aaagttgtttttgagaacgtcaaggccgccaaggtggccgtgcagtcgctgcacgaaacg
tcggttatgggaaacatcatccacgtggagctggaccccaaaggtgagaatcgcctgagg
tactttcagctcctgatgaatggcagctacaccccgcggaccctccctgttggtggagag
tcccctcggagcctggcagaagccttactggtcagtacagaatccttggtaatacgagtt
ttgttatcggagtcgagcgtaactgcagccggtggaggagtgccacccagcagctccacc
actcctgcgtctctggaaactgggtactccagcctgaggcaggaaacaccccagtcccag
ggaacccctcacaccccacgtcaggcaggtacgcccttctcccaagactccaattactcc
agccgtcagtctacgcctgcgtaccagtcaggccggccggagagctccggaggttacaag
tcacggaggcacgagagcaagttccaggacgcgtacaaccgcagaccagagaggcctcag
taccgcagcaacatgtaccgaagctcaacgtcagaacaagcgcccttcaagcagcaccag
ctcaccccgcctgaacccccaccgtcgaccccctcgttcacctacacagcccctccttcc
gctacgcccaatttaaagtccaccttctcaccctatcaggctcctctgccccctgcattc
cccccctcagaaccggttttccatcaccctacccaacgggaggacgattacccccgacca
ccgcagccgcctcaggcagctgcgcctgaatatttacccaccaaggacagaccagagact
cctccgatcccagaaccgcccccaccagagccggcgccccacccaaacacccctcctcca
caaacgccggagcagtgcccctcacctggctcacccacacacgagccagagcgcaacagc
ctggattcccgcatcgagatgctcttcaaggagaaaaggacaaagttgctgccgttcctg
gaggagcgggactcggataccgaggtgcggatggagggaagcccaatttcctcctcgtcc
tcgcagctttcgcccatcccgccttttacgggcggctcacaaggtggcctgcaaaattcc
cgtccctcaagtacgggcctggaggacatcagccccacgcctttgcctgactcggaagac
gaggagcccattcggggaactgcctcgctgctcaagagggtcagctcgcctgtgcaggac
aaggtgagcaacagtgagagaggaactaccccgacggataaaacggacacgggtcaacag
tcgtcaggagaagacatggaaatctctgacgatgaaatgccaggcacccccatcgccagc
ggagaatgtgccaagggcattgttgtcaattctgcagtgtccccgatgcagaccatgtcc
ctcccccctcctggcttcccgtctctctcgcatcagcccagcttcccgatgccgcaccac
cacctgacccctcactccgccgtcccgggtcaccctgctcacctggccggcgtgccccat
catatgctgccgcacatggacccctacgttcacagcatgatgcccctcatgcagatggag
ctgatgaactgcttgcgctgggagcagtggagcaccgtccccatgtcctttcagatgcag
cagcagatgctgagtcgcatggctcagacgagggggccgtacccgtacccacatttcatg
gacggcggtgcttcggggcccttcggggcacattatccacctctgtccatgagtgctgcc
cccggaggcactacaggaatgcctggacaccagtggcaacatcccagtttaccaacgttc
aaccctaacgtcccccctccgggttatgatgctaagaaggaggacccccacaaggcgacc
gttgacggcgtgctgctggtcatcgtcaaagagctaaaggccatcatgaagagggacctc
aaccggaaaatggtggaggtggtggctttcagagcctttgacgattggtgggataagaag
gaacgctccgcaaaggtcagtcagtcactccttcacaaggccaggagtactgagagcaaa
gaagaagaaaggcccaaacccaaagagacgatgggatcaagtctgctggaaaactggaac
aagggcgagggactgggttacgaggggatgggcctgggaatcggattacgaggagccatc
cgcttgccctccttcaaggtacgcctttgtgttttcccgaaaaaggaacctttttctgcc
gcccggtgtttgacagtggagcgctgtgttcaggtgaaaaggaagggcccgcccgaagct
gcatccgcaggcgacaacaagcgagcgcgaccatccacgccggtggatgacgagctggag
gatgaagaccgcgatcgcgacgcagccgagctcccctcggacggttccaaaatggacggc
gacggcgcgtcatccaagcgacggcactcgcgacccctggaactggacagcgaaggagag
gagaacgacacctctgggaaagaggaggagttgttatctgacagggaggaagagccggaa
gagacggaggcccctgagaggctgctgtctggaaaagaaagtggagaagaggagcgggat
gatgaagaagaggcagactcgtccagcgagagaagctcggattcatccgacgatgaagcc
gagagttcgtcctactccaaggcgagctcagactcttcatcagcaagctccgactcctcg
gagtacgagatgaactcggaggacgaggaggaggaggaggaggaggaggaggaagatgct
aaggcttcagcggcactggacaaggagtccaggagcaaaacactccagagctcctcgtcc
tcgtcctcgtcgtcttcgtcttcctcatcgacgtcttcttcatcatcgtcctcatcttct
gacgaagaggacagggaaatcaggatggaggctccatcctctcccgtgggactggctcta
aaagagaaggagggccaaaggagcaaggaggagctgagcagcaaggtcaagcgaagacct
cccagccctgaggaggagcttcctctggagcggaggccaccttcacccaaaccgactcca
ggcaccttgcccaacagcacccaggaggtgaaagccaaaggtaaaacagagcccggcgaa
gcactctttaccccaggtcgtttagccccgtcccagctggattccaaatctggaatgcac
cttcctcttcctcctcaccctgaaatagaaggccgctcccttcttcatcctccccctggc
cccctgcctgacctccctcaacgccccaggcttcccacagatgaggatatccctcgcact
cccggcagggacttgatggagcgcgcccgaagtctgggtaagtcccagagcacggacacg
gtgcccatcacccccggtggcgacgccccgctgacaggcagcagcagcctgctgctgagc
tctcctcacatccccagtagccccttctcctaccccgctcagtcccctgtcctttctgct
ggagttccacgcactccaggaagagacttaaccttcacccctgttttccccgacccagca
gcactaacgcttcataggaaagtctcctctgaaagtctggacgaccggccggtgtttaaa
gagccggctctcagcgctcttcctaaccagactctggcagctggaacagagctttcagcc
agggtccccgaggacctgccttctggtcttaacgtagatgtccctgtgccatcagatact
ggctctttaaagaagaaagctagacgacccaaaggcaaaaaggcctcggctctctctaca
tctgacgagtccttggagctctcgtcagagtcggctcctccgcctcgagacgggcacctg
gccactttgaccacgcagaggataactgcccagtctcccaaacattcgagcctggacttc
cgggatggagagctggagcgtcagacggtcttgcccgatgaagatggttttctgtcctac
gaagatgaagcaccggcgctcataaagccaacgcggaggcagcggcgtggctgggaggag
ctgctcctggacagcctgtccccggtcagctcgcctcagcgctcctacttcaagccacgc
tcagagttcgaggagatgaccattttgtacgacatctggaacgaaggcatagacgaggag
gacgtgcggctcttgcagatcacgtatgaaaagatgctgcagcaggataacggcaacgac
tggctgaatgacaccctctgggtcaaccatccttatatcctttactgctcaagaaaaaga
agggatgatggcatgcgggatcacgcaactggttgtgcgagaagtgagggatattacaag
attgataagaaggataagatcaagtaccttcagagcactaggctgcagtctgaggagcca
ccagtggacacacagggtatgagcatccctgcacaggtccatgcctccaccagagctggc
tcagagcgccggtcggagcagcggcgcctgctctcctcctttgcgtgtgacagcgacctg
ctgaagttcaaccagctcaagttccggaagaaaaagatccgcttctgcaaatcgcacatc
cacgactggggtctgtttgccctggagcccatcgctgctgatgaaatggtgattgaatac
gtggggcagaacatccgacaggtgatcgcagacatgcgggagaaacgttacgaggaggag
ggcatcggcagcagctacatgttccgcgttgaccacgacaccatcatagacgccacaaag
tgtggcaactttgcccgtttcatcaatcacagttgcaatcctaactgttacgcgaaagtc
atcacagtggagtcgcaaaagaagatcgtgatctactccaggcagcccatcaacgttaac
gaggagatcacctacgactacaagttccccatcgaggacgttaaaatcccctgtctgtgc
ggggctgagaactgcaggggaacgctgaactag

DBGET integrated database retrieval system