KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00018052G001Help
Entry
GSTEN00018052G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tng01001]
    GSTEN00018052G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     GSTEN00018052G001
Protein kinases [BR:tng01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   GSTEN00018052G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH LELP1
Motif
Other DBs
NCBI-ProteinID: CAF99831
UniProt: Q4SHQ1
LinkDB All DBs
Position
5
AA seq 721 aa AA seqDB search
MAEKFESLMNIHGFDLGSRYMDLKPLGYGGNGLVFSAVDTDCDKRVAVKKIILTDPQSVK
HALREIKIIRRLDHDNIVKVFETLGPNGRRLTEDVVSLTEVNSVYIVQEYMETDLCQLLE
RGLLSEGHARLFMYQLLRGLKYIHSANVLHRDLKPANLFVNTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVLREEDCQELHSVIPVFIRNDMSKPHTPLAKLLPDVSPQALDFLEKILTFN
PMDRLTAEEALAHPYMADYSFPLDEPVSLHPFHIEDEVDDILLMDQSHSHTWDSSRCHES
QLSEADWHLHSTHDPDEVQVDPRGLSDVTDEEEVQVDPRKYADGDREKFLDEPSFDYSLH
FPPDRSWQENDHHENKYCDLQCSHTCNYKAVSPSYLDNLIWRDSEVNHYYEPKLIIDLSN
WKEQQSKEKADRKPRASVRRTGCTIKLSLQPEPCPEVALLNDVGFLNELNSSVSQLEAPR
SGSMSKSVSQEKEEKCLVNLAQLGGGALGLGDGTWPAEPCPSLAFGLRVEESGCLIDEAC
WDIRGEEHLQKESTYTSYLDQLFSRKEEGVVETVASLEMEASVVREVDESFLSRNAEIVL
NVQLDSLALPLPLPLPLPLPGFDGADDLPLKSIQASLTPCAVKCSPQIAHKTYSSIFKHL
N
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagtttgagtccctgatgaacatccacggttttgacctgggttctcgctac
atggacttaaagccactcggttacggcgggaatggcctggtgttctccgcagtcgacaca
gactgtgataagcgtgtggctgtgaagaaaatcatcttgaccgacccgcagagtgtgaag
catgccctgcgggaaatcaagatcatcagacgccttgaccacgacaacatagtgaaggtg
tttgagacattaggtcctaacggtcgcaggctcacagaggatgtcgtgtccctgacggag
gtcaactcggtgtacattgtgcaagagtacatggagacagacctttgtcagctgctggag
aggggccttctctcagagggccacgccagactcttcatgtaccagctcctgaggggcctt
aagtatatccactccgctaacgtgctgcaccgggacctcaagcccgctaacttgtttgtc
aatacggaggacctggtacttaagattggggattttggcctggctcgcattatggacccg
cactattctcacaagggccatctctcagagggtctggtcaccaagtggtatagatcgcct
cgtctgctgctctctccgaataactacaccaaagccatcgacatgtgggcagctggctgc
atctttgccgagatgctcacagggaaaaccctctttgctggagcccacgagctggagcag
atgcagctgattctggagtccatacctgtgctgagggaagaagactgccaagagctccac
agcgtcatccccgtcttcatccgtaacgatatgtccaagcctcacacaccactagccaag
ctgctgcctgatgtcagtccccaggccttggatttcttggagaagatcctgacgtttaac
cccatggatcggctgactgcggaagaggccctggcccacccctatatggctgactactcc
ttccccttagatgagccggtgtctctgcaccccttccacatagaggatgaggtcgacgat
atcctgctcatggaccagagtcacagccacacctgggacagtagcagatgtcacgaaagc
cagctgtcggaggccgactggcacctacacagcacccacgacccagatgaagttcaggtg
gacccgagaggactctctgacgtgacagatgaagaagaggtccaggtggaccctcgtaaa
tatgccgatggagatcgggagaagttcctggatgagccgtcctttgactactcccttcat
ttccctccagacagatcctggcaggagaatgaccaccacgagaataaatactgtgactta
cagtgtagccatacatgtaactacaaggccgtgtcaccctcgtacctagacaacctcatc
tggagggacagtgaagtcaaccactactacgagcccaagctcatcatcgacctctccaac
tggaaggagcagcagagcaaggagaaagccgaccgcaagccaagagcaagtgtgagaaga
acgggctgcaccatcaaactgagcctgcagccggagccctgtccggaggtggcgctgctc
aacgacgtgggcttcctcaacgagctcaactcctccgtctcccagctggaggctccacgc
tcgggctccatgtccaagtctgtgagccaggagaaagaggagaagtgcctggtgaacctc
gcccagttaggaggaggggcgctgggcctcggggacggcacctggcccgccgagccttgt
ccaagtttggccttcgggttgcgagtcgaggagagcggctgcttgatagacgaagcgtgc
tgggacatacgcggcgaggagcacctgcagaaggagagcacttacaccagctacctggac
cagctgttcagccggaaggaggagggcgtggtggagacggtggccagcctggagatggag
gcgtcggtggtgagagaggtggacgagagcttcctcagcaggaacgcggagatcgtgctg
aacgtgcagctggattctctggccctgcccctgcccctgcccctgccgctgcccctgccc
ggctttgacggcgccgacgacctgcctctgaaatccatccaggcctctctgactccctgc
gctgtcaaatgctccccacaaattgcccacaaaacctacagcagcattttcaagcatctt
aac

DBGET integrated database retrieval system