KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00018197G001Help
Entry
GSTEN00018197G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K03175  TNF receptor-associated factor 6 [EC:2.3.2.27]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04010  MAPK signaling pathway
tng04120  Ubiquitin mediated proteolysis
tng04140  Autophagy - animal
tng04144  Endocytosis
tng04620  Toll-like receptor signaling pathway
tng04621  NOD-like receptor signaling pathway
tng04622  RIG-I-like receptor signaling pathway
tng05132  Salmonella infection
tng05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:tng00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    GSTEN00018197G001
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    GSTEN00018197G001
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    GSTEN00018197G001
   04140 Autophagy - animal
    GSTEN00018197G001
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    GSTEN00018197G001
   04621 NOD-like receptor signaling pathway
    GSTEN00018197G001
   04622 RIG-I-like receptor signaling pathway
    GSTEN00018197G001
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    GSTEN00018197G001
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    GSTEN00018197G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tng04131]
    GSTEN00018197G001
   04121 Ubiquitin system [BR:tng04121]
    GSTEN00018197G001
Enzymes [BR:tng01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     GSTEN00018197G001
Membrane trafficking [BR:tng04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    GSTEN00018197G001
Ubiquitin system [BR:tng04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    GSTEN00018197G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-TRAF zf-C3HC4_2 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-RING_UBOX zf-C3HC4_4 zf-RING_5 Prok-RING_4 U-box Sina TRAF6_Z2 DM zf-TRAF_2
Motif
Other DBs
NCBI-ProteinID: CAF99941
UniProt: Q4SHE1
LinkDB All DBs
Position
5
AA seq 565 aa AA seqDB search
MACFDSSSKGSLEEDSCDGAIGGELSGCALVMMEKEQESLLSPSESPGTYMSGASSSFHD
GTHQQGYDVEFDPPLESKYECPICLMALRNAIQTPCGHRFCKNCIEKSIRDAGQRCPVDN
EMLSKEQLFPDNFAKREILSLIVRCSNPGCTSKMELRHLENHLASCEFATVPCPHCQQSV
KKTLLEEHTSVQCRRRPVSCPDCVEIFVYEEKERHEQQCPFASVMCPHCDMDLTRDQMES
HCDTDCPKAPIACNFSLFGCKERMQRHDLARHMQDFTQMHMHYMADFLRSLNLNGTIPKS
CSTIVHSVSFEDQGAAASASSCSKGALSSNCTPCQPTEEMQRLREMDRRLVKQDHQLREL
IILKENQTGQIAELRKRVSVLEESMRELESQHCTGIYIWRLKDFSVLLRNQEAGLPVVEH
SPGFYTGRPGYKLCLRLHLQSPVAQRCSNFISLFVHTMQGAYDGLLTWPFQGTIRLAILD
QGPEGQHHIEVMETKPDLQAFQRPTIIRNPKGFGYVTFLHLHHLKERAYVKDDALLIRCE
VTPRFDNMLHRDGVTVQPRGSEASI
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgctttgacagcagcagcaaggggagtttggaggaggacagctgtgatggagct
attggtggagagctctctggctgcgctttggtaatgatggaaaaagaacaggagtctctt
ctaagcccatcagaaagccctggcacctacatgagcggcgcttcatctagttttcatgat
ggcactcaccagcaaggctacgatgtggagtttgatcctcccttagagagcaaatatgag
tgccctatctgtctaatggcgttgaggaatgctattcagacgccctgtggtcatcgattc
tgcaagaactgcattgagaagtccattcgtgacgcgggacaaagatgccctgtggacaat
gaaatgctgtcaaaagagcagctttttcctgataactttgccaagcgggagattctttcg
ctgattgttcgctgctctaaccctggctgcaccagtaaaatggagctcagacatttagag
aatcacttggccagttgtgagtttgccactgtgccttgtccacattgccaacagtctgtg
aaaaagacccttttggaggagcatacatctgtccagtgcagaagaagacctgtatcatgt
cctgactgtgtagaaatttttgtctatgaggagaaagagcgccatgagcagcagtgtcct
tttgccagcgtgatgtgccctcattgtgacatggatctcactagggaccagatggaatct
cactgtgatactgattgccctaaagcccccattgcctgtaactttagcttgtttggatgt
aaggaaaggatgcagcgtcacgacctcgctcggcacatgcaggattttacacagatgcac
atgcactacatggcagattttctacgcagcctcaacctcaatggcacaatacccaaatcc
tgtagtacaatagtacattcggtttcctttgaggatcagggagcggcagcatcagcatcg
tcctgtagcaaaggagctttgagcagcaactgcacaccgtgccagcccactgaggagatg
cagaggctgagggagatggacagacgattggtgaagcaagatcaccaattgcgtgagctt
atcattttgaaagaaaaccagactggtcagattgcagagctcagaaaaagagtgtcagtg
ttggaggagtcgatgagggagctggagtcacagcattgtactgggatctacatctggcgc
ctcaaagatttttctgtcctgctgcggaaccaagaggccggtctgccagtcgtggagcac
agccccggtttttacacaggccgcccaggctataaactgtgcctgcgattacacctgcag
tctccagttgcccagcgctgttccaactttatctccctctttgttcacaccatgcaagga
gcctatgatgggctgctgacctggccgttccagggcaccatccgcctcgctatcctggat
caaggccctgaaggccagcaccacattgaggtaatggagaccaaaccagacctgcaggcc
ttccagaggcccaccatcatccgtaatcccaaagggttcggctacgtgacgtttctacac
ttacatcatctgaaagagagggcgtatgtcaaagatgatgctctgcttatccggtgcgag
gtcacaccacgttttgataacatgcttcaccgggatggagtaacggtacagccaagagga
tctgaagcctctata

DBGET integrated database retrieval system