KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00018365G001Help
Entry
GSTEN00018365G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    GSTEN00018365G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tng01002]
    GSTEN00018365G001
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tng04147]
    GSTEN00018365G001
Enzymes [BR:tng01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     GSTEN00018365G001
Peptidases [BR:tng01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   GSTEN00018365G001
Exosome [BR:tng04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GSTEN00018365G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-ProteinID: CAG00063
UniProt: Q4SH19
LinkDB All DBs
Position
8
AA seq 278 aa AA seqDB search
METGSRANQIKEGARLFKRAGVCWSDTKTHGEATMKAFIVLVLIAAAYAAPIDEDDKIVG
GYECRKNSVPYQVSLNSGYHFCGGSLISSSWVVSAAHCYKSRIQVRLGEHNIAVNEGTEQ
FINSAKVITHPRYNSYNLDNDIMLIKLSSPARLDSYARTVSLPSSCAGAGTSCLISGWGN
TSSSGSNYPDRLMCLNAPILSDTSCRNSYPGQISTNMFCAGFLEGGKDSCQGDSGGPVVC
NGQLQGVVSWGYGCAQRNKPGVYTKVCNYNSWLRDTMA
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggatctcgggccaatcagataaaagagggagcgagactgtttaaaagagcc
ggagtttgctggagcgacaccaagacccacggcgaagcgaccatgaaggctttcattgtt
ctggttctgattgctgcagcgtacgctgcccccatcgatgaggacgacaagatagttgga
ggctacgagtgcaggaagaactcggtgccctaccaggtctctctcaactctggctaccac
ttctgtggaggctccctgatctccagcagctgggtggtgtctgccgcccactgctacaag
tcccgtatccaggtgcgtctcggcgagcacaacattgccgtcaacgagggcaccgagcag
ttcatcaactccgccaaggtcatcactcaccccaggtacaacagctacaacctggacaac
gacatcatgctgatcaagctgagcagccccgccaggctggacagctacgcccgcaccgtc
tccctgccctccagctgtgccggggccggaacctcctgtctgatctctgggtggggcaac
accagcagctctggaagcaactaccctgaccgcctgatgtgccttaacgctcccatcctg
agcgacaccagctgcaggaactcctaccccggtcagatctccaccaacatgttctgtgct
ggattcctggagggaggcaaagactcctgccagggagactccggtggccccgtggtgtgc
aacggccagctgcagggcgtggtctcctggggttacggttgcgcccagaggaacaagccc
ggcgtctacaccaaggtctgcaactacaacagctggctccgcgacaccatggcc

DBGET integrated database retrieval system