KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00018747G001
Entry
GSTEN00018747G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K08738  cytochrome c
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04115  p53 signaling pathway
tng04210  Apoptosis
tng05132  Salmonella infection
tng05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    GSTEN00018747G001
   04115 p53 signaling pathway
    GSTEN00018747G001
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    GSTEN00018747G001
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    GSTEN00018747G001
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-ProteinID: CAG00333
UniProt: Q4SG99
LinkDB
Position
17
AA seq 104 aa
MGDIAKGKKTFVQKCAQCHTVEEGGKHKTGPNLWGLFGRKTGQAEGFSYTDANKSKGIIW
NEDTLLEYLENPKKYIPGTKMIFAGIKKKAERQDLIAYLKSSTS
NT seq 312 nt   +upstreamnt  +downstreamnt
atgggagacatcgcaaaaggaaagaaaacctttgtccagaagtgtgcccagtgtcacaca
gtcgaggaggggggcaagcacaagacgggccccaacctctggggcctgtttggacgcaag
actggacaggcggagggcttctcctacacagatgccaacaagagtaaagggattatttgg
aacgaggacaccctgctggaatatttagagaaccccaagaagtatattcctggaaccaaa
atgatctttgctggcatcaagaagaaggcagagcgccaggacctgattgcgtacctgaaa
tcatcaacctcg

DBGET integrated database retrieval system