KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00019048G001Help
Entry
GSTEN00019048G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K03355  anaphase-promoting complex subunit 8
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04110  Cell cycle
tng04114  Oocyte meiosis
tng04120  Ubiquitin mediated proteolysis
tng04914  Progesterone-mediated oocyte maturation
Module
tng_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:tng00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    GSTEN00019048G001
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00019048G001
   04114 Oocyte meiosis
    GSTEN00019048G001
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    GSTEN00019048G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:tng04121]
    GSTEN00019048G001
   03036 Chromosome and associated proteins [BR:tng03036]
    GSTEN00019048G001
Ubiquitin system [BR:tng04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     GSTEN00019048G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    GSTEN00019048G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC8 TPR_1 TPR_2 TPR_8 TPR_14 TPR_16 TPR_11 TPR_19 TPR_7 TPR_12 ANAPC3 TPR_17 TPR_9 TPR_15
Motif
Other DBs
NCBI-ProteinID: CAG00574
UniProt: Q4SFK8
LinkDB All DBs
Position
7
AA seq 573 aa AA seqDB search
MAALCSEFGDLVQIKKQLIAVICLCKERGLLQSAKWASELAFALAPLPKDELPPSPPFTE
EDAQDLDALTLAKSYFDLKEYDRAAYFLKGCCSQKSYFLYMYSRYLSGEKKKDDETVDSL
GPLEKGQVQNEALRELRVELSKKHIAGELDGFTLYLTAWYLRKLDLIKEAVEVFVEAIHA
LPLHWGAWLELGNLVTNNEMLKSLSLPDCWIKDFFMAHMYTELQMIKEALQKYQNLIEAG
FSKSTYIISQIAVAYHNIRDIDQALAMFNELRDQDPYRIDNMDTFSNLLYVKSMKPELSY
LAHNLVEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRCLGAWTLMGHEYMEM
KNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILRMPFYCLYYYRKAHQLRPNDSRMLVA
LGESYEKLSQQAEAKKCYWRAYSVGDVEKMALLKLAKLHEQLNESDDAAQCYMLYIQDIF
SCGEQLEHAEVSTALRYLGQYYFKNKLYDEASLCAQRCCDYNDAREEGKALLRQISQVRD
QIETPSADLFAPLSNNNTPVRRVSPLNLISFTP
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggcggctctctgtagtgagtttggagatttggtgcaaattaaaaaacagcttatagca
gtaatatgtctttgtaaggaaagaggacttttacagagcgcaaaatgggcgtctgaactg
gcatttgctctggcaccacttccaaaggatgaattacccccatcgcctccctttactgag
gaagatgctcaagacctggacgcactaacgttggccaagtcctactttgacctgaaggaa
tatgatcgggctgcttatttcctgaaaggctgctgcagtcagaagtcttatttcctatac
atgtattcacgttacctgtcaggtgagaaaaagaaagatgatgagactgtggacagcctg
ggtcctctggagaagggtcaggtacaaaatgaagctttgcgggaactgagggtggagctg
agtaagaagcacatcgctggagagttggatggcttcaccttgtaccttacggcgtggtac
ttgcgaaagcttgacttgatcaaagaggcagtggaggtgtttgttgaggcgattcacgca
cttcctcttcactggggagcctggctggagcttgggaaccttgtcactaacaatgaaatg
ctgaagtccctgtcactgccagactgctggattaaggacttcttcatggctcacatgtac
acagagttacaaatgatcaaagaagctctgcagaaataccagaacctgatcgaagctggc
ttctccaagagcacctacatcatctctcagattgctgttgcctaccacaatatcagagat
attgaccaagccttggctatgttcaacgagctgagggatcaggatccgtatcgaatcgac
aacatggacacgttttccaacctgctgtacgtcaaaagcatgaaaccagagttgagctac
ttggctcacaacctcgtggagatcgataagtacagagtggagacatgctgcgtcattggc
aactattacagtttacgctcccagcatgagaaggcagctctgtacttccagcgggccctt
aaactcaaccctcgctgcctgggcgcgtggaccctgatgggccacgagtacatggagatg
aagaacacttcagcggccatccaagcctacagacatgccatcgaggtgaacaagcgtgac
taccgtgcctggtatggcctgggtcaaacatatgagatcctcaggatgcccttttactgt
ctgtattattatcgaaaggctcaccagcttagacccaatgactcgcgcatgttggtggct
ctgggtgaaagctatgaaaagctgtcacaacaagccgaggcaaagaagtgttactggagg
gcatactctgttggagacgtagagaagatggctctgctcaaactggcaaaactccacgaa
cagctgaacgagtctgatgatgctgctcagtgttacatgctttacatacaagacatcttt
tcctgcggggagcagctggagcatgctgaggtgagcacagctctgcggtacctgggtcag
tactatttcaagaacaagctctacgatgaggcgtccctctgcgctcagcgatgttgtgac
tacaacgatgctcgagaagagggaaaagccctgttgaggcagatctcacaagttagagat
cagattgaaacaccatcagcggacctgtttgctccgctgtccaacaacaacactcccgtc
aggagggtgtctccactcaacctcatctctttcactccc

DBGET integrated database retrieval system