KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00019217G001
Entry
GSTEN00019217G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04451  tumor protein p53
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04010  MAPK signaling pathway
tng04110  Cell cycle
tng04115  p53 signaling pathway
tng04137  Mitophagy - animal
tng04210  Apoptosis
tng04216  Ferroptosis
tng04218  Cellular senescence
tng04310  Wnt signaling pathway
tng05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    GSTEN00019217G001
   04310 Wnt signaling pathway
    GSTEN00019217G001
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    GSTEN00019217G001
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00019217G001
   04210 Apoptosis
    GSTEN00019217G001
   04216 Ferroptosis
    GSTEN00019217G001
   04115 p53 signaling pathway
    GSTEN00019217G001
   04218 Cellular senescence
    GSTEN00019217G001
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    GSTEN00019217G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tng03000]
    GSTEN00019217G001
   03036 Chromosome and associated proteins [BR:tng03036]
    GSTEN00019217G001
   03400 DNA repair and recombination proteins [BR:tng03400]
    GSTEN00019217G001
Transcription factors [BR:tng03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    GSTEN00019217G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     GSTEN00019217G001
DNA repair and recombination proteins [BR:tng03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    GSTEN00019217G001
SSDB
Motif
Pfam: P53 P53_TAD
Other DBs
NCBI-ProteinID: CAG00701
UniProt: Q4SF81
LinkDB
Position
undetermined
AA seq 271 aa
MEEETFSLPLSQDTFQDLWENVAAPSISTIQTTVSGNECWQDGSLTMALMDMPYDEDLFN
LPSELPNKDGANSSCPTVPVTTDHPGEYDFKLRFQKSGTAKSVTSTYSESLNKLYCQLAK
TSPLEVLLSREPPLGAMLRATAIYKKTEHVAEVVRRCPHHQNEDSTENRSHLIRMEGSQR
AQYFEDPHTKRQSVTVPYEPPQLGSEFTTILLSFMCNSSCMGGMNRRPILAILTLETQEG
VVLGRRCFEVRVCACPGRDRKTEEANSTKMQ
NT seq 813 nt   +upstreamnt  +downstreamnt
atggaagaggaaactttcagtctgcccttaagccaggacaccttccaagatctttgggaa
aatgtagcggctccctccatctccaccatccaaacaacagtttcaggaaatgagtgctgg
caggacggatcgttgactatggctctcatggacatgccctacgatgaggatctgttcaat
ctgccttctgagctgccaaacaaagatggcgctaactcttcctgccccaccgtcccggtc
accaccgatcaccccggagagtatgacttcaagctgcgttttcagaagtctggcacggca
aagtccgtcacctccacctactccgagagcctcaacaagctctactgccagcttgcgaag
accagtccgctggaagtgctcctgagcagggagcctccgctgggggccatgctgagggcc
actgccatttacaagaagacggagcacgtggcagaagtggtgcgccggtgcccccaccac
cagaacgaggactccacggagaaccggagccacctgatcaggatggagggcagtcagcga
gcgcagtacttcgaagatccgcacactaaacggcagagcgtcaccgtcccctacgagccc
cctcagctcgggtccgaattcaccaccatcctgctcagttttatgtgcaatagttcatgc
atggggggcatgaaccgccggcccatcctcgccatcttgaccctggaaactcaagagggt
gtcgtgttgggacggaggtgctttgaagtccgcgtctgcgcatgtccgggcagagaccgc
aaaaccgaggaggccaacagcaccaagatgcag

DBGET integrated database retrieval system