KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00019760G001Help
Entry
GSTEN00019760G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04010  MAPK signaling pathway
tng04020  Calcium signaling pathway
tng04114  Oocyte meiosis
tng04140  Autophagy - animal
tng04261  Adrenergic signaling in cardiomyocytes
tng04270  Vascular smooth muscle contraction
tng04310  Wnt signaling pathway
tng04340  Hedgehog signaling pathway
tng04371  Apelin signaling pathway
tng04530  Tight junction
tng04540  Gap junction
tng04910  Insulin signaling pathway
tng04912  GnRH signaling pathway
tng04914  Progesterone-mediated oocyte maturation
tng04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    GSTEN00019760G001
   04310 Wnt signaling pathway
    GSTEN00019760G001
   04340 Hedgehog signaling pathway
    GSTEN00019760G001
   04371 Apelin signaling pathway
    GSTEN00019760G001
   04020 Calcium signaling pathway
    GSTEN00019760G001
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    GSTEN00019760G001
  09143 Cell growth and death
   04114 Oocyte meiosis
    GSTEN00019760G001
  09144 Cellular community - eukaryotes
   04530 Tight junction
    GSTEN00019760G001
   04540 Gap junction
    GSTEN00019760G001
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    GSTEN00019760G001
   04912 GnRH signaling pathway
    GSTEN00019760G001
   04914 Progesterone-mediated oocyte maturation
    GSTEN00019760G001
   04916 Melanogenesis
    GSTEN00019760G001
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    GSTEN00019760G001
   04270 Vascular smooth muscle contraction
    GSTEN00019760G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tng01001]
    GSTEN00019760G001
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:tng03019]
    GSTEN00019760G001
   03036 Chromosome and associated proteins [BR:tng03036]
    GSTEN00019760G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     GSTEN00019760G001
Protein kinases [BR:tng01001]
 Serine/threonine kinases: AGC group
  PKA family
   GSTEN00019760G001
Messenger RNA biogenesis [BR:tng03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     GSTEN00019760G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    GSTEN00019760G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: CAG01116
UniProt: Q4SE16
LinkDB All DBs
Position
3
AA seq 336 aa AA seqDB search
VKEFLAKAKEDFLKKWENPAQQTAALDHFDRLKTLGTGSFGRVMLVKHKETGQHFAMKIL
DKQKVVKLKQIEHTLNEKRILQAVNFPFLVCLEHSFKDNSNLYMVMEYVPGGEMFSHLRR
IGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGR
TWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGK
VRFPSHFSSDLKDLLRNLLQVDLTKRFGNLRNGVNDIKGHKWFATTDWIAIYQRKVEAPF
IPKCKGPGDTSNFDDYDEEEIRVSFTEKCAKEFAEF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagagtttcttgccaaagccaaagaagatttcctgaagaaatgggagaatccagca
cagcaaactgcggcattggaccactttgaccgtttgaagaccttaggaaccggctcgttt
ggtcgagtcatgctggtcaaacataaagagacgggacaacattttgccatgaaaatacta
gacaaacagaaggtagtgaaactgaagcagatagaacacacactaaacgagaagcgcatc
cttcaagctgtcaacttcccctttctggtgtgcctggaacactcttttaaggataacagt
aatctctatatggtaatggagtacgtacctgggggggaaatgttctcgcatttaaggagg
atcggtagattcagtgaaccgcacgcccgcttttacgcagcccagattgtattgaccttc
gaataccttcactcgctggatctgatctaccgagatctgaagccggagaacctccttatt
gaccagcaaggttacatacaggtcacggatttcggcttcgctaaaagagtgaagggccgg
acctggacgctttgcgggacaccagagtacctcgcacccgagattatcctgagtaagggt
tacaacaaagctgtggactggtgggctctgggagtgctcatctacgagatggctgctggt
tatcctcctttctttgcagaccagccaattcaaatttatgagaagattgtatcggggaaa
gttcgcttcccgtctcacttcagctcagacctgaaggatttgttgagaaatttgcttcaa
gtggatctgaccaagcgcttcggcaacctcaggaacggagtcaacgatatcaagggccac
aagtggtttgccaccaccgactggatcgccatctaccagagaaaggtggaagctcccttt
attcccaagtgcaaaggccccggcgacacaagcaactttgacgactacgacgaagaggaa
atccgagtctccttcacagagaaatgtgcaaaggagtttgccgagttctag

DBGET integrated database retrieval system